BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1397 (682 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT011349-1|AAR96141.1| 1961|Drosophila melanogaster RH02355p pro... 31 1.1 AY069808-1|AAL39953.1| 1121|Drosophila melanogaster SD04942p pro... 31 1.1 AE014297-4447|AAF56945.4| 1961|Drosophila melanogaster CG31037-P... 31 1.1 AY058501-1|AAL13730.1| 1072|Drosophila melanogaster LD19406p pro... 30 3.4 AF247762-1|AAF74193.1| 1072|Drosophila melanogaster Netrin recep... 30 3.4 AE013599-2049|AAF58143.2| 1072|Drosophila melanogaster CG8166-PA... 30 3.4 >BT011349-1|AAR96141.1| 1961|Drosophila melanogaster RH02355p protein. Length = 1961 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 270 PS*LFLREATTRFTLNCRT-CTT*DLIFDLCLKFGGD---NHKAMSTTLITLN 124 P LFL A CR C T DL F+ C++F GD K ++ L+T N Sbjct: 754 PFELFLDAALQNEFNQCRDFCNTFDLSFEQCIEFAGDYLLRRKKITQALLTYN 806 >AY069808-1|AAL39953.1| 1121|Drosophila melanogaster SD04942p protein. Length = 1121 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 270 PS*LFLREATTRFTLNCRT-CTT*DLIFDLCLKFGGD---NHKAMSTTLITLN 124 P LFL A CR C T DL F+ C++F GD K ++ L+T N Sbjct: 600 PFELFLDAALQNEFNQCRDFCNTFDLSFEQCIEFAGDYLLRRKKITQALLTYN 652 >AE014297-4447|AAF56945.4| 1961|Drosophila melanogaster CG31037-PA protein. Length = 1961 Score = 31.5 bits (68), Expect = 1.1 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 270 PS*LFLREATTRFTLNCRT-CTT*DLIFDLCLKFGGD---NHKAMSTTLITLN 124 P LFL A CR C T DL F+ C++F GD K ++ L+T N Sbjct: 754 PFELFLDAALQNEFNQCRDFCNTFDLSFEQCIEFAGDYLLRRKKITQALLTYN 806 >AY058501-1|AAL13730.1| 1072|Drosophila melanogaster LD19406p protein. Length = 1072 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 675 HEFFLPVFSKLTNCIISPSSTHVFKYH 595 + F PV K+ +C+++P HV YH Sbjct: 724 YSFVKPVILKIPHCLVAPEQWHVHIYH 750 >AF247762-1|AAF74193.1| 1072|Drosophila melanogaster Netrin receptor DUnc5 protein. Length = 1072 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 675 HEFFLPVFSKLTNCIISPSSTHVFKYH 595 + F PV K+ +C+++P HV YH Sbjct: 724 YSFVKPVILKIPHCLVAPEQWHVHIYH 750 >AE013599-2049|AAF58143.2| 1072|Drosophila melanogaster CG8166-PA protein. Length = 1072 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 675 HEFFLPVFSKLTNCIISPSSTHVFKYH 595 + F PV K+ +C+++P HV YH Sbjct: 724 YSFVKPVILKIPHCLVAPEQWHVHIYH 750 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,705,793 Number of Sequences: 53049 Number of extensions: 521662 Number of successful extensions: 1002 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 984 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1002 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2971922400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -