BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1394 (604 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 70 7e-14 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 70 7e-14 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 70 7e-14 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 70 7e-14 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 27 0.62 EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. 23 5.8 AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14... 23 5.8 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 7.6 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 7.6 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 7.6 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 69.7 bits (163), Expect = 7e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 510 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 602 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 80 Score = 63.7 bits (148), Expect = 4e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKEAESCDCLQGFQ 453 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 69.7 bits (163), Expect = 7e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 510 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 602 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 80 Score = 63.7 bits (148), Expect = 4e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKEAESCDCLQGFQ 453 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 69.7 bits (163), Expect = 7e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 510 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 602 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 80 Score = 63.7 bits (148), Expect = 4e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKEAESCDCLQGFQ 453 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 69.7 bits (163), Expect = 7e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 510 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 602 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN Sbjct: 50 KIREEYPDRIMNTYSVVPSPKVSDTVVEPYN 80 Score = 63.7 bits (148), Expect = 4e-12 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 364 HYTEGAELVDSVLDVVRKEAESCDCLQGFQ 453 HYTEGAELVD+VLDVVRKE E+CDCLQGFQ Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQ 30 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 26.6 bits (56), Expect = 0.62 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 53 MREIVHIQAGQCGNQIGAKFWE 118 MRE + + GQ G QIG W+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 >EF426186-1|ABO26429.1| 133|Anopheles gambiae unknown protein. Length = 133 Score = 23.4 bits (48), Expect = 5.8 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 5/66 (7%) Frame = -1 Query: 526 YSSLILR*GGCPYRNRCRRRASVSVGIPGGNHTIPLPFE-RRLKLNRRAQHPP----CSV 362 + +L+ G +R + AS+ +GI GG H+I R A++P C+ Sbjct: 11 HMALVTTADGIEESHRSGKLASL-IGIEGG-HSIGTSLGVLRTFYQLGARYPTLTHTCNT 68 Query: 361 PWPSCC 344 PW CC Sbjct: 69 PWADCC 74 >AF117749-1|AAD38335.1| 372|Anopheles gambiae serine protease 14D2 protein. Length = 372 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 325 FGQSGAGNNWAKGHYTEGAELVDSVLDVV 411 FG G + G YT +E +D VLD + Sbjct: 343 FGLEQCGTDGVPGVYTRMSEYMDWVLDTM 371 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.0 bits (47), Expect = 7.6 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 401 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 288 K T + + CPL ++ DC +L KI KG Sbjct: 195 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 232 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.0 bits (47), Expect = 7.6 Identities = 12/38 (31%), Positives = 17/38 (44%) Frame = -3 Query: 401 KTESTSSAPSV*CPLAQLLPAPDCPKTKLSGRKICPKG 288 K T + + CPL ++ DC +L KI KG Sbjct: 196 KATGTKAHTAKYCPLKPVITPEDCLAMELRRHKIHRKG 233 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.0 bits (47), Expect = 7.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 107 KFWEIISDEHGIDPTG 154 KFW + D GI+ TG Sbjct: 225 KFWPTVCDYFGIESTG 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,231 Number of Sequences: 2352 Number of extensions: 12609 Number of successful extensions: 44 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58450473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -