BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1393 (722 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0266 + 27280592-27281668 29 2.8 06_01_0478 + 3407882-3407999,3408119-3408278,3408377-3408448,340... 28 8.6 02_02_0481 - 10815853-10816229,10816877-10816942,10817009-108173... 28 8.6 >02_05_0266 + 27280592-27281668 Length = 358 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/58 (32%), Positives = 27/58 (46%) Frame = -3 Query: 516 RLFFCNRYERD*VTIYPDF*TS*KTLGSYRREHPNFPLVNYSFSLKIRPSHLHRPLYH 343 RLFFC R +R +YPD T ++RR + ++L I P+ L L H Sbjct: 63 RLFFCPREDR----LYPDLRMPALTAEAHRRRRRRLYASPHGWTLAIDPTDLAASLLH 116 >06_01_0478 + 3407882-3407999,3408119-3408278,3408377-3408448, 3409599-3409670,3410471-3410539,3410654-3410659, 3410951-3411022,3411103-3411174,3411881-3411935, 3412139-3412366 Length = 307 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -3 Query: 120 HPCGIIT*RLVSTQSKWNKCKCNRSQLHISHLSIVSF 10 HPCG + S C C+ ++ I+HL++ + Sbjct: 62 HPCGKLVWSNSSEMEASINCSCSSNECRITHLNVTGY 98 >02_02_0481 - 10815853-10816229,10816877-10816942,10817009-10817311, 10817432-10817531,10818523-10818531 Length = 284 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -1 Query: 437 DLIAENTPIFHS*IILFR*KFVHLIYIAHCTIKNMSGTN 321 D I + P++H + LFR ++H +I C G N Sbjct: 103 DGITKKVPLYHMALKLFRDGYLHEFFIDDCITPKEGGAN 141 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,897,484 Number of Sequences: 37544 Number of extensions: 289150 Number of successful extensions: 486 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1886372480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -