BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1389X (460 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0060 - 19695338-19695477,19695641-19695734,19695818-196959... 29 1.8 12_01_0329 + 2545511-2546683,2546983-2546993,2547377-2547438,254... 27 5.5 >11_06_0060 - 19695338-19695477,19695641-19695734,19695818-19695973, 19696109-19696168,19696384-19696602,19696607-19697036, 19698428-19698747 Length = 472 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 418 STFELSELDYHCSYKVNVNRSWKNQIPESELVITIPGC 305 S F + +LD C + + + Q+ + ELVI +PGC Sbjct: 391 SMFVMVKLDLSCLQGIKDDMDFCCQLAKEELVILLPGC 428 >12_01_0329 + 2545511-2546683,2546983-2546993,2547377-2547438, 2547882-2548225 Length = 529 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 436 AATTAQSTFELSELD-YHCSYKVNVNRSWKNQIPESELVITIPG 308 A A+ T S D C YKVN++ KN ES++++ + G Sbjct: 469 AHCNARRTHTSSHTDGVQCCYKVNMSDQTKNPNLESKIILPVVG 512 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,854,053 Number of Sequences: 37544 Number of extensions: 133169 Number of successful extensions: 282 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 282 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -