BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1381X (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) 43 2e-04 SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) 39 0.003 SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) 37 0.011 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 36 0.015 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) 35 0.034 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 35 0.045 SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.079 SB_43049| Best HMM Match : DUF947 (HMM E-Value=4) 33 0.10 SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.10 SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) 33 0.18 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 33 0.18 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 32 0.24 SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.24 SB_15063| Best HMM Match : Fez1 (HMM E-Value=0.17) 32 0.24 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.32 SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) 31 0.42 SB_18944| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) 31 0.56 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) 31 0.74 SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) 30 0.97 SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_41471| Best HMM Match : Cupin_4 (HMM E-Value=0.31) 30 0.97 SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.97 SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) 30 0.97 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 30 1.3 SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) 30 1.3 SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) 30 1.3 SB_29054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 29 1.7 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) 29 1.7 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 29 1.7 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 29 2.2 SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) 29 2.2 SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) 29 2.2 SB_45073| Best HMM Match : ERM (HMM E-Value=0) 29 2.2 SB_59233| Best HMM Match : Involucrin (HMM E-Value=2.5) 29 3.0 SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) 29 3.0 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 3.0 SB_48008| Best HMM Match : M (HMM E-Value=0.0068) 29 3.0 SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) 29 3.0 SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) 29 3.0 SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) 28 3.9 SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) 28 3.9 SB_52772| Best HMM Match : rve (HMM E-Value=0.001) 28 3.9 SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) 28 3.9 SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) 28 3.9 SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) 28 3.9 SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) 28 3.9 SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) 28 3.9 SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 3.9 SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) 28 3.9 SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) 28 3.9 SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) 28 3.9 SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) 28 3.9 SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) 28 3.9 SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) 28 3.9 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_23918| Best HMM Match : rve (HMM E-Value=0.013) 28 3.9 SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) 28 3.9 SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) 28 3.9 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 28 3.9 SB_11351| Best HMM Match : LRV (HMM E-Value=6) 28 3.9 SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) 28 3.9 SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) 28 3.9 SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) 28 3.9 SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) 28 3.9 SB_47641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 28 3.9 SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34) 28 3.9 SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) 28 3.9 SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) 28 3.9 SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) 28 3.9 SB_32531| Best HMM Match : DUF827 (HMM E-Value=0.54) 28 3.9 SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) 28 3.9 SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) 28 3.9 SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) 28 3.9 SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 28 3.9 SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_59534| Best HMM Match : AA_permease (HMM E-Value=3.1e-05) 28 5.2 SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) 28 5.2 SB_12781| Best HMM Match : Spindle_assoc (HMM E-Value=0.12) 28 5.2 SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) 28 5.2 SB_17734| Best HMM Match : zf-C2H2 (HMM E-Value=0.0003) 28 5.2 SB_8304| Best HMM Match : PLAT (HMM E-Value=0) 28 5.2 SB_58199| Best HMM Match : DUF1388 (HMM E-Value=0.0002) 27 6.9 SB_46803| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) 27 6.9 SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) 27 6.9 SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 27 6.9 SB_53423| Best HMM Match : Pox_A32 (HMM E-Value=0.0095) 27 6.9 SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) 27 6.9 SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_7583| Best HMM Match : PT (HMM E-Value=6.1) 27 6.9 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15) 27 6.9 SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) 27 6.9 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 27 9.1 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 27 9.1 SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 27 9.1 SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) 27 9.1 SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) 27 9.1 SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_22827| Best HMM Match : TM_helix (HMM E-Value=0.57) 27 9.1 SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) 27 9.1 SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.1 SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) 27 9.1 >SB_56618| Best HMM Match : DUF1213 (HMM E-Value=0.022) Length = 1421 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 4/74 (5%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLES----AIQEKLQQAADRRLLIEAEQRE 170 +E L+++ E RE+ EQ+RK+ + K Q+ E +E+L+ + R ++ E+ Sbjct: 1263 EEELRRLQEE-REYREQMRKIAEARERKLQEEEEERRRQEEEQLRAIEEERRRLQEEEER 1321 Query: 171 KLRNHERRAELVRQ 212 KLR ++R E+ R+ Sbjct: 1322 KLREEQKRVEMARR 1335 Score = 36.3 bits (80), Expect = 0.015 Identities = 20/74 (27%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQ--EKFQQLESAIQEKLQQAADRRLLIEAEQREKL 176 DE + E++RE EE++R+++ + E+ +++ A + KLQ+ + R E EQ + Sbjct: 1249 DEQRRLEEEQIREAEEELRRLQEEREYREQMRKIAEARERKLQEEEEERRRQEEEQLRAI 1308 Query: 177 RNHERRAELVRQNK 218 RR + + K Sbjct: 1309 EEERRRLQEEEERK 1322 >SB_20689| Best HMM Match : Gelsolin (HMM E-Value=0.00029) Length = 1866 Score = 38.7 bits (86), Expect = 0.003 Identities = 22/74 (29%), Positives = 40/74 (54%) Frame = +3 Query: 12 LKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHER 191 LK+M ++ + +E+ K + +EK ++ EK ++ +++LLIE E+REK + ER Sbjct: 898 LKEMKDKEKIEKEKREKDKREREEKERKRRQQQLEKEKKEKEKKLLIEKEKREKEKQKER 957 Query: 192 RAELVRQNKSARTE 233 E + K E Sbjct: 958 LREKEEKEKQKEAE 971 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/79 (25%), Positives = 43/79 (54%), Gaps = 2/79 (2%) Frame = +3 Query: 3 DENLKKMIERLR-EHEEQVRKVRAGNQ-EKFQQLESAIQEKLQQAADRRLLIEAEQREKL 176 ++ K +IE+ + E E+Q ++R + EK ++ E A +EK ++ L E E++++ Sbjct: 937 EKEKKLLIEKEKREKEKQKERLREKEEKEKQKEAERAKKEK-ERLLQEDKLHEKEEKDRK 995 Query: 177 RNHERRAELVRQNKSARTE 233 +R+ E ++ K + E Sbjct: 996 DKEKRKVEKEKREKDKQVE 1014 >SB_10683| Best HMM Match : Stathmin (HMM E-Value=0.0011) Length = 299 Score = 36.7 bits (81), Expect = 0.011 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQ--AADRRLL--IEAEQREKLRN 182 K+ E+L +E V+ V+A Q ++ +EKLQQ AA + ++ + + + EKL+ Sbjct: 119 KETQEKLLAKDEHVKTVQAQAQVMAEEHSKVTEEKLQQKFAASKEIIEELRSAKEEKLQA 178 Query: 183 HERRAELVR 209 HERR + + Sbjct: 179 HERRVRVAQ 187 Score = 31.5 bits (68), Expect = 0.42 Identities = 18/67 (26%), Positives = 35/67 (52%), Gaps = 2/67 (2%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQRE--KLRNHERRAE 200 E+L+ HE +VR ++ QE+ +Q I+EK+ Q + E K R HE+ + Sbjct: 174 EKLQAHERRVRVAQSIAQEQIEQQSKLIEEKIMQKMEMTKEKRDSYMEALKTRLHEKSLD 233 Query: 201 LVRQNKS 221 + ++ ++ Sbjct: 234 VEQKRQT 240 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/67 (28%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 9 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKL--QQAADRRLLIEAEQ-REKLR 179 +L+ M+E+ R+ E++ K+ +++K QQLE+ +Q K Q A+ ++ E EQ R++ + Sbjct: 1231 DLQSMVEQDRQRAERMEKLALEHEKKVQQLETELQSKSSGQGGANEAIIKEMEQLRQEQQ 1290 Query: 180 NHERRAE 200 +++ + + Sbjct: 1291 DYQHKLD 1297 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 36.3 bits (80), Expect = 0.015 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGN--QEKFQQLESAIQEKLQQAADRRLLIEAEQREKLR 179 E ++ E+ R EE RK +EK + E + KLQ+ ++R L EAE++EK R Sbjct: 245 EERRRQEEKRRAEEEAKRKAEEEKAAREKAEMEEKLRRLKLQEKEEKRKL-EAEKKEKER 303 Query: 180 -NHERRAELVRQNKSARTE 233 E+R E +Q + R E Sbjct: 304 VEREQREERRKQEEKRRAE 322 Score = 31.9 bits (69), Expect = 0.32 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 4/78 (5%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRL----LIEAEQREK 173 E L+K E+ E E ++R+ + ++ +QE+ + AA R L +E E++E+ Sbjct: 170 EMLRKEQEQQEEEERRIREEEERQKALKEERMRKLQEEARLAAQRALEEKRKLEEERKEQ 229 Query: 174 LRNHERRAELVRQNKSAR 227 R + AEL ++ + R Sbjct: 230 ERKEKELAELEKKRQEER 247 Score = 30.7 bits (66), Expect = 0.74 Identities = 20/59 (33%), Positives = 33/59 (55%) Frame = +3 Query: 36 REHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVRQ 212 +E E Q + R G + + Q+ +EK Q+ + RL +EAE R++ + +RAE RQ Sbjct: 392 KERERQEEERRKGEERQRQE-----EEKRQKEEEERLRVEAE-RQREEDERQRAEDERQ 444 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 35.9 bits (79), Expect = 0.020 Identities = 22/76 (28%), Positives = 43/76 (56%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E +K IE R+ +E++R+ +A +++ ++ E ++E+LQ + R IEA +E Sbjct: 1164 EESQKAIEAARKKQEEIRQKQAAWRQQEEE-EQRVKERLQILREERERIEALNKEADLLI 1222 Query: 186 ERRAELVRQNKSARTE 233 +RR E R+ + R + Sbjct: 1223 QRRKEAERKAEEKRKQ 1238 >SB_1307| Best HMM Match : Filament (HMM E-Value=0.13) Length = 916 Score = 35.1 bits (77), Expect = 0.034 Identities = 18/68 (26%), Positives = 34/68 (50%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 ++N + L H+ ++ +++ + E Q LES I+E+L +D + + +R Sbjct: 337 EDNERSKTRLLEYHKHEILQMKTNHNEVIQSLESRIEEELSIKSDIQTHVHTLERNIQAL 396 Query: 183 HERRAELV 206 E R ELV Sbjct: 397 EEERKELV 404 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/72 (25%), Positives = 39/72 (54%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E L K + + EE++RK++ + + ES +K ++ ++ + ++ + LR H Sbjct: 491 EKLNKESTKRQNLEEEIRKLQLQVCSQGGEKESDRLQKKIRSLEKTISQMIDENDNLRRH 550 Query: 186 ERRAELVRQNKS 221 E++ + + QNKS Sbjct: 551 EKKLKDLEQNKS 562 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 34.7 bits (76), Expect = 0.045 Identities = 22/79 (27%), Positives = 42/79 (53%), Gaps = 2/79 (2%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQL-ESAIQEKLQQAADRRLLIEAEQREKLR 179 D + K ++ HEE+++ ++K QQ+ E ++KLQ+ DR + E ++E+++ Sbjct: 512 DGDAPKKSKKKLTHEEKLKLAEEEKEKKKQQIQEDKEKKKLQKEKDRAVEREKREKERVQ 571 Query: 180 NH-ERRAELVRQNKSARTE 233 E+ E RQ + R E Sbjct: 572 KKLEKDKERERQREQKRKE 590 >SB_32768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 33.9 bits (74), Expect = 0.079 Identities = 19/58 (32%), Positives = 30/58 (51%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAE 200 ER RE E + +VR +E+ ++ E + E+ + +RR E EQR + RR E Sbjct: 1080 ERRREEERKREEVRRLEEERKREEERRLAEQRRVEEERRRKEEEEQRRREEEERRRRE 1137 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/65 (32%), Positives = 38/65 (58%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELV 206 ER R+ EE+ R+ R + + ++ E ++E+ ++ + R L E E+ E+ R ERR E Sbjct: 1116 ERRRKEEEEQRR-REEEERRRREEEDRLREEARRREEERRL-EDERWEREREEERRWEEE 1173 Query: 207 RQNKS 221 R+ +S Sbjct: 1174 RRRRS 1178 >SB_43049| Best HMM Match : DUF947 (HMM E-Value=4) Length = 209 Score = 33.5 bits (73), Expect = 0.10 Identities = 18/62 (29%), Positives = 38/62 (61%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 K++ ++ REH+E++RK+ +K++Q+E L + RR ++E QR++ E++ Sbjct: 150 KRIDDKNREHQEELRKLNEEQNDKYEQVEIDCIVALNE---RRKILE-RQRQEREELEQK 205 Query: 195 AE 200 A+ Sbjct: 206 AD 207 >SB_56374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 483 Score = 33.5 bits (73), Expect = 0.10 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 24 IERLRE-HEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKL 176 IE+L++ HEE++ + + ++E +QEKL+ RR +E E+ E+L Sbjct: 422 IEQLKKKHEEEMAEFEKAQELNKTRVEQGLQEKLRARRSRRRKMEVEKAEEL 473 >SB_13773| Best HMM Match : TolA (HMM E-Value=0.042) Length = 1558 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 2/60 (3%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQE--KFQQLESAIQEKLQQAADRRLLIEAEQREKL 176 DEN+ K E L++ +E+ + E + ++ ++A++E + A + + +E +QREKL Sbjct: 1260 DENMAKFSENLKKEQERTKAALRERLEARRKKKKDAAMKEITKAAKEEKEALEQQQREKL 1319 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 32.7 bits (71), Expect = 0.18 Identities = 19/77 (24%), Positives = 39/77 (50%), Gaps = 1/77 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAAD-RRLLIEAEQREKLRN 182 E ++ +ER R E+ ++ + E+ +++ +E++++ + RR E +RE+ R Sbjct: 338 EKRRQEVERKRREREEAKRKQLEEAERLERVRLEAEEEMKRREEERRKKREEAERERKRK 397 Query: 183 HERRAELVRQNKSARTE 233 E +Q K AR E Sbjct: 398 EEEERNREKQEK-ARLE 413 Score = 29.9 bits (64), Expect = 1.3 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAAD-RRLLIEAEQREKLRN 182 E + +R E K R + K ++ E A +++L++A R+ +EAE+ K R Sbjct: 321 EKEARAAKRAEERAAAAEKRRQEVERKRREREEAKRKQLEEAERLERVRLEAEEEMKRRE 380 Query: 183 HERR 194 ERR Sbjct: 381 EERR 384 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 32.3 bits (70), Expect = 0.24 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = +3 Query: 27 ERLREHEEQV---RKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRA 197 ERLR+ +EQ+ RK R + K +Q E + K+Q RR + E+ +K R+ E R Sbjct: 597 ERLRKIQEQMELERKRREEEERKRKQEEEERKRKMQMELQRR---KEEEEQKKRDEEERK 653 Query: 198 ELVRQNK 218 ++ K Sbjct: 654 RREKEEK 660 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/63 (22%), Positives = 35/63 (55%) Frame = +3 Query: 24 IERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAEL 203 +ER R EE+ RK + +E+ ++++ +Q + ++ ++ E +R + +R+ +L Sbjct: 608 LERKRREEEE-RKRKQEEEERKRKMQMELQRRKEEEEQKKRDEEERKRREKEEKDRQFQL 666 Query: 204 VRQ 212 +Q Sbjct: 667 EKQ 669 >SB_24046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2848 Score = 32.3 bits (70), Expect = 0.24 Identities = 13/54 (24%), Positives = 34/54 (62%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE 188 ERLR+ EE+ + +++ + + ++++ ++ +RRL++E ++RE+ + E Sbjct: 1444 ERLRKEEEERKMEEERRRDEQARRDKELEDQKRKDEERRLIMEQQERERRQEME 1497 Score = 30.3 bits (65), Expect = 0.97 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQ-REKLRN 182 E LK+ IER E EE++ + +E+ ++ + Q+ L+Q R EAE+ R +L Sbjct: 1573 EELKR-IER--EKEEELERQMREKEEEMERQKQVFQDTLEQERRLRNDREAEEARRRLEE 1629 Query: 183 HERRAELVRQNK 218 R E RQ + Sbjct: 1630 ASRSEEYERQRQ 1641 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 32.3 bits (70), Expect = 0.24 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 3/74 (4%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQR---EKL 176 E L K+ + L + +++ V+ + KFQ+ ++ QEK L+ QR E Sbjct: 707 EALTKVSKELEQTNQELENVKCSMEGKFQENQNVFQEKCAALRKEEELVNKLQRQLKESE 766 Query: 177 RNHERRAELVRQNK 218 + ER+ E++ + Sbjct: 767 ESIERKVEIIESGR 780 >SB_15063| Best HMM Match : Fez1 (HMM E-Value=0.17) Length = 444 Score = 32.3 bits (70), Expect = 0.24 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 5/68 (7%) Frame = +3 Query: 30 RLREHEEQVRKVRAGNQEKFQQLESAIQE---KLQQAAD--RRLLIEAEQREKLRNHERR 194 RL+E E +++ A +QE +QL+ +I++ +L+ D RRL + A Q++K H+++ Sbjct: 137 RLKEQVESLQREIAQSQENERQLQGSIKKLKVQLKNETDEVRRLKMNAVQQKKQFAHDKK 196 Query: 195 AELVRQNK 218 + NK Sbjct: 197 KQEREMNK 204 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 31.9 bits (69), Expect = 0.32 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 12 LKKMIERLRE----HEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLR 179 L+K E++++ EEQ +K +A QEK ++ + ++EK+Q + + RE LR Sbjct: 1612 LRKAKEKIKQGSARQEEQTKKYKA-YQEKREKDVAELREKVQSLEKELMETSEKLREDLR 1670 Query: 180 NHERRAE 200 E+R E Sbjct: 1671 GSEKREE 1677 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 31.9 bits (69), Expect = 0.32 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +3 Query: 3 DENLKKMIERLREHEE---QVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREK 173 +E ++++E RE EE Q + G QEK ++L+ ++ +L++ +++ I E Sbjct: 340 EEAQRRILEDRREVEEIEQQAAEQLKGQQEKEEELKRLLERQLEEEKEKKEYIRREAERL 399 Query: 174 LRNHERRAE 200 LR AE Sbjct: 400 LREERLIAE 408 >SB_27989| Best HMM Match : Involucrin2 (HMM E-Value=1.2) Length = 192 Score = 31.5 bits (68), Expect = 0.42 Identities = 22/75 (29%), Positives = 41/75 (54%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 DE+ +K E+ E E+ RK+RA +E Q+L I+E+ Q+ + + E++ R Sbjct: 12 DESKRKEEEKRLEEMERQRKIRAAERE--QRL---IEEETQKRVEEMVAKRVEEQLAKRK 66 Query: 183 HERRAELVRQNKSAR 227 E E++R+ + A+ Sbjct: 67 DEIDKEVMRRVEEAK 81 >SB_18944| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.5 bits (68), Expect = 0.42 Identities = 22/75 (29%), Positives = 41/75 (54%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 DE+ +K E+ E E+ RK+RA +E Q+L I+E+ Q+ + + E++ R Sbjct: 22 DESKRKEEEKRLEEMERQRKIRAAERE--QRL---IEEETQKRVEEMVAKRVEEQLAKRK 76 Query: 183 HERRAELVRQNKSAR 227 E E++R+ + A+ Sbjct: 77 DEIDKEVMRRVEEAK 91 >SB_23913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 905 Score = 31.5 bits (68), Expect = 0.42 Identities = 27/77 (35%), Positives = 41/77 (53%), Gaps = 6/77 (7%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQL----ESAIQEKL-QQAADRRLLIEAEQRE 170 EN++K E+ + Q +K N + Q++ E I E L +QA D+RL EA RE Sbjct: 813 ENMEKSFEKAAQDYAQ-QKQEGFNARRQQRVTTHHERVIHEVLSEQARDQRLRAEARARE 871 Query: 171 -KLRNHERRAELVRQNK 218 KL +R AE +Q++ Sbjct: 872 RKLDKTKRDAERSKQDR 888 >SB_15350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1126 Score = 31.5 bits (68), Expect = 0.42 Identities = 13/41 (31%), Positives = 28/41 (68%) Frame = +3 Query: 78 QEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAE 200 QEK Q+L+ AI+EK ++ +R +E ++++K+ +++ E Sbjct: 751 QEKTQRLKYAIEEKAKKERERMEQLEIQRQKKVEEQKKKRE 791 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/62 (25%), Positives = 33/62 (53%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 ++++ R +E EEQ R+ + + Q+ E+ + R++ E E++EK ER+ Sbjct: 877 QELLLRKQEFEEQERQRKIAEAKHQQEEREKDMERERTEEKARIMKEIEEKEKKEEAERK 936 Query: 195 AE 200 A+ Sbjct: 937 AK 938 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/69 (23%), Positives = 36/69 (52%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E +K+ E + EE+ + + E+ ++ I+EK ++ R E ++RE+ R Sbjct: 890 ERQRKIAEAKHQQEEREKDMERERTEEKARIMKEIEEKEKKEEAERKAKEEKEREE-RER 948 Query: 186 ERRAELVRQ 212 +R +L+++ Sbjct: 949 KRICQLLKE 957 Score = 27.9 bits (59), Expect = 5.2 Identities = 19/73 (26%), Positives = 42/73 (57%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 K+ ER R+ Q+ K +A + + ++L+ A +EKL+ A ++ + E E+ KL +R Sbjct: 941 KEREERERKRICQLLKEKAEQERRERELK-AREEKLRLAREQMMREERERTLKLELERKR 999 Query: 195 AELVRQNKSARTE 233 E ++++++ + Sbjct: 1000 MEERLKDQASKND 1012 >SB_14482| Best HMM Match : Cornifin (HMM E-Value=3.7) Length = 301 Score = 31.1 bits (67), Expect = 0.56 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + R ART + P R P A HPG AGRR Sbjct: 22 QEPGKPAREPARTPVAALPAPARVTSPEPPATRPHPGRVEAGRR 65 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/42 (35%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 6 ENLKKMIER-LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQ 128 E K++I + L EE++ +VR Q+K +QLE+ ++E+ Q+ Sbjct: 2276 ERDKQLISKELEAKEEELEEVRYSMQKKIKQLEAQLEEEYQE 2317 >SB_15458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 31.1 bits (67), Expect = 0.56 Identities = 24/60 (40%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +3 Query: 48 EQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE-QREKLRNHERRAELVRQNKSA 224 EQ +K G +E+ ++L + I EKLQQ D L E E EK+ + EL+RQ +SA Sbjct: 126 EQRKKEADGYRERNEKLAAEI-EKLQQGKDH-LTKECEASSEKIVTLLKEIELLRQTRSA 183 >SB_49663| Best HMM Match : TolA (HMM E-Value=0.059) Length = 591 Score = 30.7 bits (66), Expect = 0.74 Identities = 29/118 (24%), Positives = 47/118 (39%), Gaps = 3/118 (2%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E +K E R+ EEQ RK + K + + +E+ + +RR E E R K Sbjct: 411 EARRKEQEEKRKLEEQKRKEEEDRRRKEAEEKRIKEEEARLKEERRSKDEEENRRKADEE 470 Query: 186 ERRAEL--VRQNKSARTETXXXXXXXXXXXXDTRLSRSRHNC-QI*HLSHTPTNINSQ 350 +R E +N+ + E ++R ++ QI + PTNI Q Sbjct: 471 RKRKEQEEAERNRVVQEEKRKIEQEGKQRKKESRKQEEQNKKEQILNKMAEPTNIRKQ 528 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/73 (20%), Positives = 39/73 (53%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E +++ + + EE+ +K + ++K +++E E+ + + + EAE++ +++ Sbjct: 306 EEMQRKTQEKKRIEEEEQKRKEAEEKKAKEIEQRRMEEEIKKEEEKKRKEAEEK-RVKEE 364 Query: 186 ERRAELVRQNKSA 224 + R E R+ K A Sbjct: 365 QIRLEKERKRKEA 377 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/58 (25%), Positives = 32/58 (55%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAE 200 +R RE EE++ ++ E+ ++++ QEK + + + EAE+++ +RR E Sbjct: 290 QRKREREEELERI-----ERVEEMQRKTQEKKRIEEEEQKRKEAEEKKAKEIEQRRME 342 >SB_55587| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.13) Length = 359 Score = 30.3 bits (65), Expect = 0.97 Identities = 12/54 (22%), Positives = 34/54 (62%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE 188 ERLR+ +E+ + +++ + + ++++ ++ +RRL++E ++RE+ + E Sbjct: 258 ERLRKEKEERKMEEERRRDEQARRDRELEDQQRKDEERRLIMEQQERERRQEME 311 >SB_49860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 362 Score = 30.3 bits (65), Expect = 0.97 Identities = 15/63 (23%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE-QREKLRNHERRAEL 203 ER++E E+ +K++ QEK +L + + L++ +R+ +E E R++++N + + Sbjct: 302 ERIKEEVEKQKKIKLEQQEK--ELRDKLLKNLKEMKERKQELERELLRKQIKNKVKLNSI 359 Query: 204 VRQ 212 +++ Sbjct: 360 IKK 362 >SB_41471| Best HMM Match : Cupin_4 (HMM E-Value=0.31) Length = 406 Score = 30.3 bits (65), Expect = 0.97 Identities = 19/77 (24%), Positives = 41/77 (53%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 ++ L+ +++R ++ E + R V+ N+E + ++EK Q+A R+L +E Q+E+ Sbjct: 296 EQELRDILKREKD-EAKARAVKRKNEEVTRLRNERLEEKRQEAL-RKLELERIQKEQEEK 353 Query: 183 HERRAELVRQNKSARTE 233 +R + AR + Sbjct: 354 AKREQVYEALRRKARNQ 370 >SB_37749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1103 Score = 30.3 bits (65), Expect = 0.97 Identities = 18/71 (25%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = +3 Query: 24 IERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE-RRAE 200 I R R ++ K R + ++ + I+ + ++ A R L +RE+ R E RR E Sbjct: 573 IRRQRTERQRQAKAREVRDAREKERQDRIRRERERIARERALERERERERERERERRRLE 632 Query: 201 LVRQNKSARTE 233 +R+ + + E Sbjct: 633 YMREQRRRQEE 643 >SB_28087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1501 Score = 30.3 bits (65), Expect = 0.97 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIE---AEQREKLRNH 185 ++M E R EEQ R+ +E + Q + +E L++ +RRL + E+R++ Sbjct: 1267 ERMEEERRYIEEQRRREEQEEEEFYLQQQREREEILRREEERRLKTQRRIMEERQRAEEE 1326 Query: 186 ERRAELVRQNKSARTE 233 +EL ++ + R E Sbjct: 1327 IHHSELPQRKRKIRFE 1342 >SB_26233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 30.3 bits (65), Expect = 0.97 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 5/70 (7%) Frame = +3 Query: 39 EHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH-----ERRAEL 203 E E+Q + QEK ++L +E ++ +L +A+++EK R ER E Sbjct: 278 EEEKQKEEAERKKQEKLEKLAKKKEELKERKRQEKLEQKAKKKEKERQEREKEKEREKER 337 Query: 204 VRQNKSARTE 233 ++Q K + E Sbjct: 338 IQQEKEKQKE 347 >SB_17268| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.7) Length = 434 Score = 30.3 bits (65), Expect = 0.97 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = +3 Query: 9 NLKKMIERLREHEEQVRKVRAGNQEKFQQLE----SAIQEKLQQAADRRLLIEAEQREKL 176 N +K R EH+ V K+ + +FQQ +A QE+ + RR ++E E++ L Sbjct: 325 NAQKRRMRQLEHKRAVEKLIEDRRMQFQQEREAELAARQEEERMEMYRRQIVEQERQRLL 384 Query: 177 RNH 185 R H Sbjct: 385 REH 387 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/77 (23%), Positives = 37/77 (48%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 ++ ++K E +R E +++ ++K Q E ++EKL R + E ++RE Sbjct: 107 EKEMQKWQESVRYQTELEKQLIEKEKKKQQAYEEFLKEKLMIDEIVRKIYEEDEREIANR 166 Query: 183 HERRAELVRQNKSARTE 233 E++ R K +T+ Sbjct: 167 LEKQRATQRYIKEFKTK 183 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/65 (24%), Positives = 37/65 (56%) Frame = +3 Query: 33 LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVRQ 212 L++ + Q ++ R Q++ QQL+ Q++LQQ ++L + QR++ +++ + +Q Sbjct: 1498 LQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQRELQQQQQQQQQQQ 1557 Query: 213 NKSAR 227 + R Sbjct: 1558 LQRQR 1562 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/68 (26%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKL--QQAADRRLLIEAEQREKLRNHE 188 ++ ++ R+ E Q ++ + Q++ QQL+ Q++L QQ +R L + +Q+++ + + Sbjct: 1500 QQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQRELQQQQQQQQQQQLQ 1559 Query: 189 RRAELVRQ 212 R+ EL +Q Sbjct: 1560 RQRELQQQ 1567 >SB_23458| Best HMM Match : MCPVI (HMM E-Value=1.4) Length = 770 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PAAR +HPG AGRR Sbjct: 225 EPPAARPKHPGRVEAGRR 242 >SB_15392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 29.9 bits (64), Expect = 1.3 Identities = 11/77 (14%), Positives = 46/77 (59%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 ++ K+ + ++E ++Q + + +E+ Q+++ ++++Q+ +++ ++ EQ+++++ Sbjct: 20 EQQQKEQKQEVQEEQKQEEQKQEVQEEQKQEVQEEQKQEVQE--EQKQKVQEEQKQEVQK 77 Query: 183 HERRAELVRQNKSARTE 233 +++ E Q + + E Sbjct: 78 EQKQEEQEEQKQEVQEE 94 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/64 (23%), Positives = 36/64 (56%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELV 206 ++ E EEQ ++V+ Q++ +Q E +E+ Q+ + + E E++++ E++ E+ Sbjct: 79 QKQEEQEEQKQEVQE-EQKQEEQEEQKQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQ 137 Query: 207 RQNK 218 + K Sbjct: 138 EEQK 141 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/69 (18%), Positives = 38/69 (55%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELV 206 ++ E EEQ ++ + ++ Q+ E ++K + +++ ++ EQ+++++ E++ E+ Sbjct: 95 QKQEEQEEQKQEEQKQEVQEEQKQEEQEEQKQEVQEEQKQEVQEEQKQEVQ-EEQKQEVQ 153 Query: 207 RQNKSARTE 233 + K E Sbjct: 154 EEQKQEEQE 162 >SB_7216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1400 Score = 29.9 bits (64), Expect = 1.3 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 5/73 (6%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESA-----IQEKLQQAADRRLLIEAEQR 167 ++ L +M R R E + V A NQ+ +QLE + + EK ++ E E R Sbjct: 852 EKALAEMASRARSAESDLAFVEAENQDLLKQLEESKGMYLLLEKRYHLLKNKVK-ELEDR 910 Query: 168 EKLRNHERRAELV 206 EK+ E+ +LV Sbjct: 911 EKISKQEKSDKLV 923 >SB_56497| Best HMM Match : Extensin_2 (HMM E-Value=0.16) Length = 814 Score = 29.9 bits (64), Expect = 1.3 Identities = 16/65 (24%), Positives = 37/65 (56%) Frame = +3 Query: 33 LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVRQ 212 L++ + Q ++ R Q++ QQL+ Q++LQQ ++L + QR++ +++ + +Q Sbjct: 152 LQQQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQRELQQQQQQQQQQQ 211 Query: 213 NKSAR 227 + R Sbjct: 212 LQRQR 216 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/68 (26%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKL--QQAADRRLLIEAEQREKLRNHE 188 ++ ++ R+ E Q ++ + Q++ QQL+ Q++L QQ +R L + +Q+++ + + Sbjct: 154 QQQYQQQRQRELQQQQQQQLQQQQQQQLQQQQQQQLQQQQLQRQRELQQQQQQQQQQQLQ 213 Query: 189 RRAELVRQ 212 R+ EL +Q Sbjct: 214 RQRELQQQ 221 >SB_29054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/77 (23%), Positives = 41/77 (53%), Gaps = 6/77 (7%) Frame = +3 Query: 21 MIERLREHEEQVRKVRAGN-QEKF----QQLESAIQEK-LQQAADRRLLIEAEQREKLRN 182 ++ ++H ++R+ A Q+K +++ A+ E+ ++ A+ R EA+ +EK Sbjct: 275 LLSAFQDHTNRMRQKLADQMQQKVDDEDERIAKALAEREAKREAEERAKFEADMKEKRGI 334 Query: 183 HERRAELVRQNKSARTE 233 HE R ++R+++ E Sbjct: 335 HEHRISMMRESERKAAE 351 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/65 (26%), Positives = 36/65 (55%), Gaps = 1/65 (1%) Frame = +3 Query: 27 ERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE-RRAEL 203 E R EE+ R+ +E+ ++ + +EK ++ +R+ E E+++K + E +R E Sbjct: 444 EERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEEKKRKEE 503 Query: 204 VRQNK 218 R++K Sbjct: 504 ERKHK 508 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/65 (26%), Positives = 33/65 (50%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E ++ E R+ EE+ RK R +EK ++ E Q + ++ + E +++E+ R H Sbjct: 449 EEEERREEEERKREEEERKQRE-EEEKKREEEERKQREEEERKQKEKEEEKKRKEEERKH 507 Query: 186 ERRAE 200 + E Sbjct: 508 KEEEE 512 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/66 (21%), Positives = 31/66 (46%) Frame = +3 Query: 36 REHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVRQN 215 RE EE+ + R + + ++ +E+ +Q + E E+R++ ER+ + + Sbjct: 438 REAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEERKQREEEERKQKEKEEE 497 Query: 216 KSARTE 233 K + E Sbjct: 498 KKRKEE 503 >SB_21688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1078 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 9 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRR 143 N++KM+E R+ + K+R N F Q +A Q L ++ R Sbjct: 225 NVQKMLENSRQENSRTLKIRGQNSAFFSQQLTAFQVWLAMGSEMR 269 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/73 (19%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE--QREKLR 179 E+ ++ +ER ++ +++ ++ + ++ Q++++ ++++ Q+ RR+ IE + + EK R Sbjct: 74 EHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEIEKQRMESEKKR 133 Query: 180 NHERRAELVRQNK 218 E + + + ++K Sbjct: 134 ILESKQKRIEESK 146 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +2 Query: 65 PRR*PGEVPAARERHPGEAAAGRR 136 P R P E PA R +HPG AGRR Sbjct: 1064 PARTP-EPPATRPKHPGRVEAGRR 1086 >SB_8951| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 434 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/72 (23%), Positives = 39/72 (54%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 +E +K+ ERL E++ + Q + ++ E QE+L+Q + R E ++R++ Sbjct: 226 EEEERKVQERLWLEREEIAQQEF--QRRLEREEKREQERLEQESRIREEWEEQERKEKER 283 Query: 183 HERRAELVRQNK 218 ER+ + +++ + Sbjct: 284 QERKQKSIKEKE 295 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 29.5 bits (63), Expect = 1.7 Identities = 14/73 (19%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE--QREKLR 179 E+ ++ +ER ++ +++ ++ + ++ Q++++ ++++ Q+ RR+ IE + + EK R Sbjct: 192 EHKQRGLERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEIEKQRMESEKKR 251 Query: 180 NHERRAELVRQNK 218 E + + + ++K Sbjct: 252 ILESKQKRIEESK 264 >SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) Length = 1266 Score = 29.1 bits (62), Expect = 2.2 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +3 Query: 81 EKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVRQNK 218 EKF+Q+ESA Q K + RR L+ E E HE +L + K Sbjct: 786 EKFRQIESAYQSKDPEGELRRRLLRLED-ENTELHEYATKLEKAVK 830 >SB_10027| Best HMM Match : Gp-FAR-1 (HMM E-Value=0.31) Length = 635 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG+ AGRR Sbjct: 554 EPPATRPKHPGQVKAGRR 571 >SB_3881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 368 Score = 29.1 bits (62), Expect = 2.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG+ AGRR Sbjct: 254 EPPATRPKHPGQVEAGRR 271 >SB_1330| Best HMM Match : Phage_Coat_Gp8 (HMM E-Value=1.9) Length = 482 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + + ART + GP R P A HPG AGRR Sbjct: 93 QEPGKRHQEPART--PVAAGPARITSPEPPATRPHPGRVEAGRR 134 >SB_45073| Best HMM Match : ERM (HMM E-Value=0) Length = 504 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +3 Query: 42 HEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLI-EAEQREKLRNHER-RAELVRQN 215 HE +R+ + E Q A +EK+++ +R L+ EAE R K N + E ++Q+ Sbjct: 265 HELYMRRRKPDTIEVQQMKAQAREEKVRREKERNALVKEAEARTKAENDRKLLEEKLKQS 324 Query: 216 KSARTE 233 ++ + E Sbjct: 325 EAEKEE 330 Score = 27.1 bits (57), Expect = 9.1 Identities = 20/66 (30%), Positives = 36/66 (54%), Gaps = 1/66 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQR-EKLRN 182 E ++ E R +E++ K R ++ + LE +QE Q+A +RL E E+ ++LR Sbjct: 329 EEMRAAQEEERRIKEELEKERKLIEQNRELLEKRVQE--QEAETQRLQEEFERALDELRL 386 Query: 183 HERRAE 200 ++R E Sbjct: 387 DQQRRE 392 >SB_59233| Best HMM Match : Involucrin (HMM E-Value=2.5) Length = 138 Score = 28.7 bits (61), Expect = 3.0 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = +3 Query: 39 EHEEQVRKVRAGNQEKFQQLESAIQEKL-QQAADRRLLIEAEQREKLRNHERRAELVRQN 215 E E++ K+R N+ FQ+ E ++ + QQ A R E +Q+E+ R E A +QN Sbjct: 2 ESLERLEKIRQANENSFQEQERHLERLISQQEAVYRQQSE-QQKEQQRLREELA--AQQN 58 Query: 216 K 218 K Sbjct: 59 K 59 >SB_35742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG+ AGRR Sbjct: 803 EPPATRPKHPGQIEAGRR 820 >SB_24709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 540 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 187 EPPATRPKHPGRVGAGRR 204 >SB_12412| Best HMM Match : Kinesin (HMM E-Value=6.3e-15) Length = 1001 Score = 28.7 bits (61), Expect = 3.0 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +3 Query: 12 LKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQE-KLQQAADRRLLIEAEQREKLRNHE 188 LKK+ +EH + +R+ +A N + +QL + + + K +A + + + + K R Sbjct: 729 LKKVQAAKKEHAQLIRE-KANNDMRLKQLSNEVSDMKKTKARLMKQMKDEVAKNKQRESA 787 Query: 189 RRAELVRQNKSAR 227 R E+ + K +R Sbjct: 788 RNKEIAQLKKVSR 800 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/51 (21%), Positives = 30/51 (58%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIE 155 D+ +K + EHEEQ++ + A ++++ + L ++++++ + R + E Sbjct: 709 DDGNRKSEDLRMEHEEQIQALMAQHEDQVKALSQEYEDQIRELREERDISE 759 >SB_48008| Best HMM Match : M (HMM E-Value=0.0068) Length = 1068 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/65 (23%), Positives = 37/65 (56%), Gaps = 2/65 (3%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAE--QREKLR 179 ++L+ ++ LREHE +++K +E+ LE + E L + + ++ + E+ ++E++ Sbjct: 564 DSLEADVKILREHESELKKEMTSLKERNHNLEQMLNELLAKDSGQQTVGESSPARQEEIN 623 Query: 180 NHERR 194 R+ Sbjct: 624 RISRK 628 >SB_32504| Best HMM Match : TolA (HMM E-Value=0.52) Length = 422 Score = 28.7 bits (61), Expect = 3.0 Identities = 15/71 (21%), Positives = 35/71 (49%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 KK + L+E +++ K R +EK ++ +++ ++ ++ E E REK + + Sbjct: 127 KKSDKELKEEKKEKEKERMKKEEKHKEKTRKEEKEREKEKEKTKKEEKESREKEKTKKEE 186 Query: 195 AELVRQNKSAR 227 E ++K + Sbjct: 187 KESKEKDKQKK 197 >SB_151| Best HMM Match : zf-CCHC (HMM E-Value=8.9e-05) Length = 1382 Score = 28.7 bits (61), Expect = 3.0 Identities = 20/63 (31%), Positives = 28/63 (44%) Frame = +3 Query: 30 RLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVR 209 RL H VR + A QEK +L S +EK+ + R ++ E R +R L R Sbjct: 587 RLETHNVHVRSMSAALQEKVDELLSIWEEKVSNISKR--FKDSFAPETTRRSSQRKVLTR 644 Query: 210 QNK 218 K Sbjct: 645 GKK 647 >SB_59554| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1247 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 636 EPPATRPKHPGRVEAGRR 653 >SB_59335| Best HMM Match : rve (HMM E-Value=0.0065) Length = 1020 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 570 EPPATRPKHPGRVEAGRR 587 >SB_58624| Best HMM Match : E-MAP-115 (HMM E-Value=0.24) Length = 298 Score = 28.3 bits (60), Expect = 3.9 Identities = 19/75 (25%), Positives = 40/75 (53%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E++++ E+ R +E+ +++ +EK ++ E +EK ++ +R E E+REK R Sbjct: 87 ESMEEDREKRRREKEEEERLKRAEEEKRRE-EKRREEKRREEELKRERKEQERREKERQR 145 Query: 186 ERRAELVRQNKSART 230 + + KS+ T Sbjct: 146 LEKEKKEIGFKSSTT 160 >SB_52772| Best HMM Match : rve (HMM E-Value=0.001) Length = 646 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 87 EPPATRPKHPGRVEAGRR 104 >SB_50440| Best HMM Match : SOUL (HMM E-Value=1.7) Length = 437 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 168 EPPATRPKHPGRVEAGRR 185 >SB_50296| Best HMM Match : TP2 (HMM E-Value=9.8) Length = 278 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 186 EPPATRPKHPGRVEAGRR 203 >SB_50235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 501 EPPATRPKHPGRVEAGRR 518 >SB_48415| Best HMM Match : Pox_A32 (HMM E-Value=0.014) Length = 988 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + R ART + R P A HPG AGRR Sbjct: 797 QEPGKQRREPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 840 >SB_48252| Best HMM Match : Ribosomal_60s (HMM E-Value=1.1) Length = 937 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 687 EPPATRPKHPGRVEAGRR 704 >SB_45755| Best HMM Match : GPW_gp25 (HMM E-Value=0.47) Length = 624 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 472 EPPATRPKHPGRVEAGRR 489 >SB_43834| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1227 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 961 EPPATRPKHPGRVKAGRR 978 >SB_43260| Best HMM Match : Gemini_mov (HMM E-Value=0.94) Length = 294 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 46 EPPATRPKHPGRVEAGRR 63 >SB_43173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 879 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 502 EPPATRPKHPGRVEAGRR 519 >SB_40442| Best HMM Match : zf-MYM (HMM E-Value=2.7) Length = 235 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 98 EPPATRPKHPGRVEAGRR 115 >SB_38421| Best HMM Match : Pox_A32 (HMM E-Value=0.022) Length = 1144 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 832 EPPATRPKHPGRVKAGRR 849 >SB_37598| Best HMM Match : TrbF (HMM E-Value=0.3) Length = 419 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 48 EPPATRPKHPGRVEAGRR 65 >SB_33182| Best HMM Match : rve (HMM E-Value=0.00043) Length = 801 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_27883| Best HMM Match : TrbF (HMM E-Value=1.5) Length = 389 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 28.3 bits (60), Expect = 3.9 Identities = 17/73 (23%), Positives = 38/73 (52%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 E+ K + E + EE+ + A N++ FQ+ +S I+E + ++ L++ REK Sbjct: 202 ESEKSLKEEKYKLEEEFQANVASNEKNFQKWKSEIEEHFME--EKAKLLQNAAREKAELE 259 Query: 186 ERRAELVRQNKSA 224 ++ + + + + A Sbjct: 260 QKYLDEITELRQA 272 >SB_23918| Best HMM Match : rve (HMM E-Value=0.013) Length = 1785 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_20408| Best HMM Match : rve (HMM E-Value=0.0034) Length = 887 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 357 EPPATRPKHPGRVKAGRR 374 >SB_20195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1351 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1218 EPPATRPKHPGRVEAGRR 1235 >SB_15366| Best HMM Match : rve (HMM E-Value=0.00011) Length = 1178 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 620 EPPATRPKHPGRVKAGRR 637 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1086 EPPATRPKHPGRVEAGRR 1103 >SB_11351| Best HMM Match : LRV (HMM E-Value=6) Length = 194 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_10207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1105 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 777 EPPATRPKHPGRVEAGRR 794 >SB_9088| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 884 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_3288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 352 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 58 EPPATRPKHPGRVEAGRR 75 >SB_1077| Best HMM Match : rve (HMM E-Value=2.1e-17) Length = 794 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 211 EPPATRPKHPGRVEAGRR 228 >SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) Length = 353 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 189 EPPATRPKHPGRVEAGRR 206 >SB_49595| Best HMM Match : POPLD (HMM E-Value=1.1) Length = 1141 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1018 EPPATRPKHPGRVEAGRR 1035 >SB_48686| Best HMM Match : rve (HMM E-Value=1.2e-19) Length = 722 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 294 EPPATRPKHPGRVEAGRR 311 >SB_47641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 28.3 bits (60), Expect = 3.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 374 REKRHYVSIGRR*V*TERDASNVASKSF 457 R KRH+VS RR + + RDA A K++ Sbjct: 228 RRKRHFVSCSRRSLASRRDARACAPKAY 255 >SB_41374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 769 EPPATRPKHPGRVEAGRR 786 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 2007 EPPATRPKHPGRVEAGRR 2024 >SB_39575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 770 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 42 EPPATRPKHPGRVEAGRR 59 >SB_38320| Best HMM Match : SSDP (HMM E-Value=0.34) Length = 273 Score = 28.3 bits (60), Expect = 3.9 Identities = 16/68 (23%), Positives = 37/68 (54%) Frame = +3 Query: 30 RLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVR 209 RLR+ ++Q ++ + Q++ QQ + Q+K QQ + + +Q+++ + H++R + + Sbjct: 22 RLRKTKQQQQQQQKQQQQQQQQQQKQQQQKQQQQQQQ----QQQQQQQQQQHQQRTDKKQ 77 Query: 210 QNKSARTE 233 R E Sbjct: 78 TEIDRRME 85 >SB_37603| Best HMM Match : Pox_A32 (HMM E-Value=0.0085) Length = 1411 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1204 EPPATRPKHPGRVEAGRR 1221 >SB_36474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1608 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 976 EPPATRPKHPGRVEAGRR 993 >SB_34780| Best HMM Match : Pox_A32 (HMM E-Value=0.018) Length = 625 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 463 EPPATRPKHPGRVEAGRR 480 >SB_32880| Best HMM Match : rve (HMM E-Value=3.4e-05) Length = 1264 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 781 EPPATRPKHPGRVEAGRR 798 >SB_32531| Best HMM Match : DUF827 (HMM E-Value=0.54) Length = 341 Score = 28.3 bits (60), Expect = 3.9 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 5/82 (6%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRA-GNQEKFQQL-ESAIQEKLQQAADRRLLIEAEQREKL 176 D +KK+ ER+ E ++ V ++++ G +E L S + +K + + LIE + K+ Sbjct: 237 DTEIKKL-ERVDEIQKLVHELQSLGLKENANTLISSLVNKKRSEEQLKESLIEERNKAKM 295 Query: 177 RNHERRAELV---RQNKSARTE 233 R ER+ + V RQ K A E Sbjct: 296 RALERKEQEVMRLRQEKIAGKE 317 >SB_32247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1513 EPPATRPKHPGRVEAGRR 1530 >SB_29678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 851 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 690 EPPATRPKHPGRVEAGRR 707 >SB_28931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1035 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 385 EPPATRPKHPGRVEAGRR 402 >SB_26625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 705 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 171 EPPATRPKHPGRVEAGRR 188 >SB_24923| Best HMM Match : rve (HMM E-Value=1.5e-11) Length = 1445 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1023 EPPATRPKHPGRVEAGRR 1040 >SB_24601| Best HMM Match : DUF934 (HMM E-Value=1.5) Length = 343 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 38 EPPATRPKHPGRVEAGRR 55 >SB_14410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 710 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 553 EPPATRPKHPGRVEAGRR 570 >SB_13182| Best HMM Match : Pox_A32 (HMM E-Value=0.033) Length = 745 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 433 EPPATRPKHPGRVEAGRR 450 >SB_8696| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 1152 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 788 EPPATRPKHPGRVKAGRR 805 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 217 EPPATRPKHPGRVEAGRR 234 >SB_1527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 826 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 809 EPPATRPKHPGRVEAGRR 826 >SB_308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 3.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 5 EPPATRTKHPGRVEAGRR 22 >SB_59534| Best HMM Match : AA_permease (HMM E-Value=3.1e-05) Length = 889 Score = 27.9 bits (59), Expect = 5.2 Identities = 17/73 (23%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLE-SAIQEKLQQAADRRLLIEAEQREKLR 179 DE+++ ++++ + +++V N+E +Q E QEK+++ L + +RE+ Sbjct: 310 DEDMEALVKKHETQKNLMKEVAKANEEIKRQSEVKKQQEKMEELKVMEYLKQKAEREEA- 368 Query: 180 NHERRAELVRQNK 218 ++R E +R K Sbjct: 369 -YQREQEKIRIEK 380 >SB_57673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 508 Score = 27.9 bits (59), Expect = 5.2 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 2/64 (3%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQL-ESAIQEKLQQAADRRL-LIEAEQREKL 176 +EN++ MI R + E+++ ++ A + QQL E + + +QA ++ L +E E E L Sbjct: 304 EENIEGMIRRRKLLEDELARITASLDQATQQLFEKRNKTEEEQATEKELGHMELEIDEVL 363 Query: 177 RNHE 188 E Sbjct: 364 NERE 367 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 27.9 bits (59), Expect = 5.2 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 7/84 (8%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRR-------LLIEAE 161 +E K+ ERL+ E ++ EK ++ E ++E ++ A+RR LI+ + Sbjct: 373 EEEQNKLQERLKAVESKIIVGGVNLLEKAKEQELLLEESAKELAERRERQENLQKLIKEK 432 Query: 162 QREKLRNHERRAELVRQNKSARTE 233 ++E++ E+ A L ++ S +T+ Sbjct: 433 EQERIDIEEKYASL-QEEASGKTK 455 >SB_15422| Best HMM Match : TACC (HMM E-Value=6.4e-20) Length = 1362 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/67 (23%), Positives = 35/67 (52%) Frame = +3 Query: 9 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE 188 +L + ++L+ E +K N+E ++ QEKL+++ ++ L++ EK+ Sbjct: 352 DLHRRYDKLKGVVENFKK----NEEILKKAARDYQEKLKKSEEKYQLLKKHAEEKIETRL 407 Query: 189 RRAELVR 209 R A+L + Sbjct: 408 RHAQLAK 414 >SB_12781| Best HMM Match : Spindle_assoc (HMM E-Value=0.12) Length = 200 Score = 27.9 bits (59), Expect = 5.2 Identities = 21/78 (26%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 D+ K+ E+ E E + K AG + + + + A++ ++ + + +EA + +R Sbjct: 83 DQLRHKVEEKTNEVERNISKT-AGIRSELENTKKALKGSEERVSSLQKTVEARE-STIRT 140 Query: 183 HERRA-ELVRQNKSARTE 233 E R ELVRQ K E Sbjct: 141 LECRVDELVRQKKKITEE 158 >SB_12729| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.3e-08) Length = 1183 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/51 (21%), Positives = 35/51 (68%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQR 167 +++ L++HEE+VR+++ ++ ++++ A++E++ + R +++E+R Sbjct: 213 RQLENMLKDHEEEVRRMKEERKDLCEEIK-ALREEVNEFKARVSHLKSEER 262 >SB_17734| Best HMM Match : zf-C2H2 (HMM E-Value=0.0003) Length = 369 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 45 EEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVR 209 EE VR + + QQ+ QE++Q+ RR+ + + +E+ HE + E+V+ Sbjct: 275 EEIAEMVRGEFENQLQQVRVQSQEEMQREL-RRMNQKWKSKEERLQHEHQKEVVK 328 >SB_8304| Best HMM Match : PLAT (HMM E-Value=0) Length = 1182 Score = 27.9 bits (59), Expect = 5.2 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%) Frame = +3 Query: 15 KKMIER-LREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHER 191 KK ER LRE EE+ ++ A +K ++ EK ++ A+ R E E+R K + + Sbjct: 908 KKDEERHLREEEEERQRKEAAKGKKEEE------EKKEKEAEERRRAEDEERIKKQAEKD 961 Query: 192 RAELVRQNK 218 R + +++ K Sbjct: 962 RKKAIKKRK 970 >SB_58199| Best HMM Match : DUF1388 (HMM E-Value=0.0002) Length = 638 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPG--EAAAGRRPTS 145 R P A RT GT R PG V +A+ R PG ++A R P++ Sbjct: 398 RTPSTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPST 446 >SB_46803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPG--EAAAGRRPTS 145 R P A RT GT R PG V +A+ R PG ++A R P++ Sbjct: 35 RTPSTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPGTVKSAQVRTPST 83 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.5 bits (58), Expect = 6.9 Identities = 22/76 (28%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = +3 Query: 3 DENLKKMIERLREHEEQVRKVRAGNQEKF-QQLESAIQEKLQQAADRRLLIEAEQREKLR 179 +E L + IE R+H +R+ A +Q +QLE+A+ ++ Q AAD+ L E + + Sbjct: 158 EERLHETIEG-RDHILALRESEAASQLNLVKQLEAALLKQKQSAADKDQL-EYDIQSSKS 215 Query: 180 NHERRAELVRQNKSAR 227 + + + E + + AR Sbjct: 216 DSQTKMEKLSNDYEAR 231 >SB_22958| Best HMM Match : RasGAP_C (HMM E-Value=0.23) Length = 1178 Score = 27.5 bits (58), Expect = 6.9 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 11/77 (14%) Frame = +3 Query: 36 REHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLL----IEAEQREK-------LRN 182 RE E +V+ V A E+ +L+ +Q+ DR+ + I+A R K ++ Sbjct: 125 REVELKVKMVEAKFHEEKLKLQQQHDVAVQKILDRKNMELEEIKAHYRNKVTEMETTIKK 184 Query: 183 HERRAELVRQNKSARTE 233 HER++EL+ K+ E Sbjct: 185 HERKSELILDRKNMELE 201 >SB_11312| Best HMM Match : Ank (HMM E-Value=2.1e-18) Length = 516 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 50 TSSQGPRR*PGEVPAARERHPGEAAAGRR--PTSA 148 T SQ +R P ++ ++ PG AAGRR P SA Sbjct: 476 TGSQAGKRTPKKMDKVKKASPGSRAAGRRTNPPSA 510 >SB_8501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 543 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +3 Query: 12 LKKMIERLREHEEQVRKVRAGNQEKFQQLESAI 110 LKK+++ E E + K NQ+K ++L+++I Sbjct: 68 LKKVVKTAEEKREALEKELKKNQQKLEELQASI 100 >SB_1939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1646 Score = 27.5 bits (58), Expect = 6.9 Identities = 16/70 (22%), Positives = 35/70 (50%) Frame = +3 Query: 18 KMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRA 197 K +E++ E+ RK +++ +QLE Q++L++ R E ++RE+ + + Sbjct: 137 KEMEQIAMELEEKRKEEEEKEKQRKQLEVEKQKRLEEERIRSQNEERKRREREQKEREKQ 196 Query: 198 ELVRQNKSAR 227 + + K R Sbjct: 197 QKLDMEKEER 206 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQ-EKFQQLESAIQEKLQQAADRRLLIEAEQREKLRN 182 E + +E R+ EE+ K R + EK ++LE +E+++ + R E EQ+E R Sbjct: 140 EQIAMELEEKRKEEEEKEKQRKQLEVEKQKRLE---EERIRSQNEERKRREREQKE--RE 194 Query: 183 HERRAELVRQNKSARTE 233 +++ ++ ++ + R + Sbjct: 195 KQQKLDMEKEERRRRQQ 211 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/76 (21%), Positives = 41/76 (53%), Gaps = 5/76 (6%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKF----QQLESAIQEKLQ-QAADRRLLIEAEQRE 170 E +K +E ++ + ++R+ N+E+ +Q E Q+KL + +RR + E+++ Sbjct: 157 EKQRKQLEVEKQKRLEEERIRSQNEERKRREREQKEREKQQKLDMEKEERRRRQQEEEKK 216 Query: 171 KLRNHERRAELVRQNK 218 + E+R ++ ++ + Sbjct: 217 RREEEEKRKKVEKEKQ 232 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNH 185 +NLK I RL + E ++ I Q + + IEA+Q+E L + Sbjct: 2115 QNLKNKITRLEAYNETYENKVKDLSDELVDARHKIATLESQTEEAQQKIEAQQKELLDAY 2174 Query: 186 ERRAELVRQNKSA 224 ++ A+L +SA Sbjct: 2175 KKIADLEAALQSA 2187 >SB_53423| Best HMM Match : Pox_A32 (HMM E-Value=0.0095) Length = 1148 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA + +HPG+ AGRR Sbjct: 711 EPPATQPKHPGQVRAGRR 728 >SB_48789| Best HMM Match : M (HMM E-Value=1.3e-10) Length = 2478 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/92 (20%), Positives = 43/92 (46%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 ++ + L++ E+Q + +EK +++ +EK+QQ + + AE E LR + Sbjct: 1462 EEQVSTLKKAEDQSKAQVKEKEEKSKKVLIQAREKIQQLTALKDKLSAE-NEDLRKMAKA 1520 Query: 195 AELVRQNKSARTETXXXXXXXXXXXXDTRLSR 290 A +++ S R+ ++RL++ Sbjct: 1521 ASEAKESLSQRSSELEMRLSVLQSQYESRLAK 1552 >SB_38433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/59 (18%), Positives = 30/59 (50%) Frame = +3 Query: 18 KMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERR 194 ++I ++ E V ++ +E+F L +++ ++ + + E+R+K + E+R Sbjct: 15 RLIPVVKRRNEAVNRLNKTKEERFPDLRQEREQRDREEREEEKKSQREKRQKEKEEEKR 73 >SB_22224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/47 (25%), Positives = 26/47 (55%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRL 146 E ++ ++R +E +EQ RK +E+ ++ + K ++ AD+ L Sbjct: 993 EKRERELQRKKERDEQKRKKEEEKREREEKKRKEEERKRREKADKEL 1039 >SB_7583| Best HMM Match : PT (HMM E-Value=6.1) Length = 501 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 43 EPPANRPKHPGRVEAGRR 60 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 27.5 bits (58), Expect = 6.9 Identities = 19/68 (27%), Positives = 34/68 (50%) Frame = +3 Query: 30 RLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAELVR 209 R + EE R+ + +E +++++A++EK + + + EQR K E R E Sbjct: 323 RKKAREEAERQAKLDKEE--ERMQNAMEEKERHDREEAERLAEEQRMK---EEERKEREE 377 Query: 210 QNKSARTE 233 Q + AR E Sbjct: 378 QERIAREE 385 >SB_5414| Best HMM Match : WD40 (HMM E-Value=6.6e-15) Length = 490 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +1 Query: 295 VTTVRFDICHTRPPTSTVRFDTLTQMP*KTPLRINRTTLSVN 420 V V C+T P T++ T P K+P+R RT V+ Sbjct: 212 VAKVTIKRCNTPPKKLTIKCACPTTQPTKSPVRAGRTACPVS 253 >SB_364| Best HMM Match : Tim17 (HMM E-Value=0.45) Length = 437 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG+ GRR Sbjct: 49 EPPATRPKHPGQVETGRR 66 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/56 (23%), Positives = 33/56 (58%) Frame = +3 Query: 24 IERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHER 191 +E++++ ++V A +E+F++ S ++++LQ + +E E +E + +ER Sbjct: 624 MEQVQQRNQEV--FEAQQKEQFEKQLSLVKDELQPYKSKCQELEQENKELMEKYER 677 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +3 Query: 15 KKMIERLREHEEQVRKVRAGNQEKFQQLESAIQE 116 +K+ + L+E EEQ+ +++ QEK ++L+ +E Sbjct: 1363 EKLKQTLQEREEQIERLKEEFQEKSRELDKMRKE 1396 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 27.1 bits (57), Expect = 9.1 Identities = 18/78 (23%), Positives = 42/78 (53%), Gaps = 6/78 (7%) Frame = +3 Query: 3 DENLKKMIERLREHE--EQVRKVRAGNQEKFQQLESAIQEKLQQAADRR----LLIEAEQ 164 + N K ++ L+E + E+ ++ + +E+ + A+Q+K Q+ +RR LL++ ++ Sbjct: 557 EANNKSKVQSLQEIQRIEEEKERKTLEKERREAEARALQQKQQEEEERRRQQELLLQRQR 616 Query: 165 REKLRNHERRAELVRQNK 218 E+ ++ L RQ + Sbjct: 617 EEEEMRRQQEQMLQRQRE 634 >SB_42014| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 1007 Score = 27.1 bits (57), Expect = 9.1 Identities = 19/59 (32%), Positives = 32/59 (54%) Frame = +3 Query: 12 LKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHE 188 ++K I R+RE E +++R NQE+ Q++E E L+ A + E+R+ N E Sbjct: 6 VEKGINRIRESTEIHQQLREKNQEQQQRIEELTCE-LELAYQE--IKNTEERKNYENSE 61 >SB_37178| Best HMM Match : fn3 (HMM E-Value=4.7e-08) Length = 961 Score = 27.1 bits (57), Expect = 9.1 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 1/72 (1%) Frame = +3 Query: 6 ENLKKMIERLREHEEQVRKVRAGNQEKFQQLESA-IQEKLQQAADRRLLIEAEQREKLRN 182 E++ MIER EEQV+++ +E+ Q+E A + E+ + + R E+ +++ R+ Sbjct: 187 EDIDLMIER---EEEQVKQLTKAYREELTQIEKAFVTERSELIENNRKKWESSMQQR-RD 242 Query: 183 HERRAELVRQNK 218 E R+N+ Sbjct: 243 KEVEYMEARRNR 254 >SB_15943| Best HMM Match : Pox_A32 (HMM E-Value=0.027) Length = 804 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + + ART + R P A HPG AGRR Sbjct: 583 QEPGKQHQEPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 626 >SB_6357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1650 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AGRR Sbjct: 1276 EPPATRPKHPGWVEAGRR 1293 >SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/42 (33%), Positives = 27/42 (64%) Frame = +3 Query: 9 NLKKMIERLREHEEQVRKVRAGNQEKFQQLESAIQEKLQQAA 134 +L+ + R++E EE+ K+R + E+ +LE ++ K Q+AA Sbjct: 301 SLEAALRRVKELEEENAKIRKQSAEEKDELEKSV--KRQEAA 340 >SB_23541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 957 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + + ART + R P A HPG AGRR Sbjct: 771 QEPGKQHQEPARTPVAAVPAAARITSPEPPATRPHPGRVEAGRR 814 >SB_22827| Best HMM Match : TM_helix (HMM E-Value=0.57) Length = 969 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 83 EVPAARERHPGEAAAGRR 136 E PA R +HPG AG+R Sbjct: 701 EPPATRPKHPGRVEAGKR 718 >SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) Length = 249 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 78 QEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRA 197 +E F E+ + + ++A RR++ E E++E+ RRA Sbjct: 188 KEIFSSEENKLAKMKEEAKQRRIVREKEEKEREMEERRRA 227 >SB_14243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1507 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/53 (24%), Positives = 32/53 (60%) Frame = +3 Query: 45 EEQVRKVRAGNQEKFQQLESAIQEKLQQAADRRLLIEAEQREKLRNHERRAEL 203 +EQ+ ++A +E+ Q ++ +QE++ +A + +E ++++ + HE EL Sbjct: 155 QEQMSSLQANYEEEIQTVKEQLQEQMLRANE---AVEKYEQQEYQFHENLNEL 204 >SB_9870| Best HMM Match : GspM (HMM E-Value=1.9) Length = 522 Score = 27.1 bits (57), Expect = 9.1 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 5 REPQEDDRASART*GTSSQGPRR*PGEVPAARERHPGEAAAGRR 136 +EP + + ART + R P A HPG AGRR Sbjct: 160 QEPGKQHQEPARTPVAALPAAARVTSPEPPATRPHPGRVEAGRR 203 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,087,393 Number of Sequences: 59808 Number of extensions: 196014 Number of successful extensions: 976 Number of sequences better than 10.0: 149 Number of HSP's better than 10.0 without gapping: 834 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -