BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1376 (830 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.5 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 4.6 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +2 Query: 59 LKKWQIQL*IFLYAGNYRKALDKKNTIVQPLSNSVSWESGFHHLFLLCNRN 211 +KK + +L A NY K+ + + N + + G +H + + N N Sbjct: 188 MKKTYNNIDYYLLAANYTGWYLTKHNVPEQRLNYFTEDVGLNHFYFMLNHN 238 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 24.2 bits (50), Expect = 1.5 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +2 Query: 59 LKKWQIQL*IFLYAGNYRKALDKKNTIVQPLSNSVSWESGFHHLFLLCNRN 211 +KK + +L A NY K+ + + N + + G +H + + N N Sbjct: 188 MKKTYNNIDYYLLAANYTGWYLTKHNVPEQRLNYFTEDVGLNHFYFMLNHN 238 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.5 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 95 TKKSRVEFATSLITDEKRLGTRKSKSHT 12 TKK +E+ I + ++LG+ +SKS + Sbjct: 57 TKKMILEYELRRIREIEKLGSERSKSRS 84 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 52 SVIKEVANSTLDFFVCW 102 SVIK ++ + FF+CW Sbjct: 267 SVIKMLSAVVILFFICW 283 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,861 Number of Sequences: 438 Number of extensions: 5152 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26581563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -