BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1372 (839 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1446 + 33670845-33670953,33670980-33671048,33671579-33671967 29 6.1 10_07_0084 + 12748685-12749146 28 8.1 >04_04_1446 + 33670845-33670953,33670980-33671048,33671579-33671967 Length = 188 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 222 GGIMLFLNSIFRKFCFCRHCFLNC 151 G I+ F NS+FR RH F+ C Sbjct: 62 GQIITFANSVFRNLEIVRHLFMEC 85 >10_07_0084 + 12748685-12749146 Length = 153 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -1 Query: 563 LTLTHCCSSISKLLLWVGSKSYCN-PRDFTVNITIPIFNFV 444 L LTHC ++ L +W+ + +DF + +P+ NF+ Sbjct: 112 LVLTHCLLTVEILSIWIVLSNIMRWKKDFEFSAYMPLQNFI 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,208,635 Number of Sequences: 37544 Number of extensions: 278028 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -