Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--1372
         (839 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g33620.1 68417.m04775 Ulp1 protease family protein low simila...    30   1.7  

>At4g33620.1 68417.m04775 Ulp1 protease family protein low
           similarity to SP|Q9BQF6 SUMO-1-specific protease 2 (EC
           3.4.22.-) (Sentrin-specific protease SENP7) {Homo
           sapiens}; contains Pfam profile PF02902: Ulp1 protease
           family, C-terminal catalytic domain
          Length = 783

 Score = 30.3 bits (65), Expect = 1.7
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
 Frame = -2

Query: 637 NIKLIKKSLIFCPINC-FKYCLNINF*PSLTVVPASVNYY 521
           N+ L +K  IF PINC F + L I   P   +VP+ VN++
Sbjct: 382 NVDLFEKDYIFIPINCSFHWSLVIICHPG-ELVPSHVNFH 420


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,614,691
Number of Sequences: 28952
Number of extensions: 272903
Number of successful extensions: 536
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 529
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 536
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1941125600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)