BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1367 (817 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 4.5 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 4.5 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 4.5 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 4.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.9 AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. 22 5.9 AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. 22 5.9 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 710 RLATFLAYINVNNINRCSYCYNNYSL*RHCNKV 612 ++ + L+ ++N N Y YNN + +C K+ Sbjct: 80 KIISSLSNRTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 710 RLATFLAYINVNNINRCSYCYNNYSL*RHCNKV 612 ++ + L+ ++N N Y YNN + +C K+ Sbjct: 80 KIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 710 RLATFLAYINVNNINRCSYCYNNYSL*RHCNKV 612 ++ + L+ ++N N Y YNN + +C K+ Sbjct: 80 KIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.6 bits (46), Expect = 4.5 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 710 RLATFLAYINVNNINRCSYCYNNYSL*RHCNKV 612 ++ + L+ ++N N Y YNN + +C K+ Sbjct: 80 KIISSLSNKTIHNNNNYKYNYNNNNYNNNCKKL 112 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 267 IFLNHSTNLYLFVKNKHTLFN*YAQQICMYVSY 169 +FL H+TNL + + + +Q+ Y++Y Sbjct: 369 LFLGHATNLIQSLDSSRRQYREKVKQVEEYMAY 401 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.9 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -2 Query: 267 IFLNHSTNLYLFVKNKHTLFN*YAQQICMYVSY 169 +FL H+TNL + + + +Q+ Y++Y Sbjct: 337 LFLGHATNLIQSLDSSRRQYREKVKQVEEYMAY 369 >AM158085-1|CAJ43389.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 683 LYRPGMLQASLFIIPHRHQ 739 L+ PG+++ASL + RH+ Sbjct: 100 LHDPGLMEASLIGLVERHK 118 >AM158084-1|CAJ43388.1| 171|Apis mellifera globin 1 protein. Length = 171 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 683 LYRPGMLQASLFIIPHRHQ 739 L+ PG+++ASL + RH+ Sbjct: 100 LHDPGLMEASLIGLVERHK 118 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 214,697 Number of Sequences: 438 Number of extensions: 4671 Number of successful extensions: 19 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25974678 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -