BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1364 (767 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 25 0.88 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 25 0.88 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 3.6 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 24.6 bits (51), Expect = 0.88 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 185 TDKEMSRKRPTALQ*RPTVSPLLREPGAT 271 T E + P A + P SPL++EPG++ Sbjct: 78 TSPEPDPEIPVAPEPAPLASPLVQEPGSS 106 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 24.6 bits (51), Expect = 0.88 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 8/65 (12%) Frame = +1 Query: 82 RPPGGGHTNIFDSEPE--PPRTGRRAVPPSAT------STFSHGQGDEPKATNGTSVATN 237 R PGG H+ EPE ++ VP S + + FS GQ + P ++ + Sbjct: 16 RSPGGDHSENMQDEPENLSNKSNSITVPLSISTGQRLPANFSFGQVNSPPSSTSSGSLGQ 75 Query: 238 GQSTP 252 +TP Sbjct: 76 FPATP 80 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 159 TKRNEHFQPRTRR*AESDQRH 221 T+RN +++PRT R ++H Sbjct: 227 TRRNPYYRPRTSRTEPPRRKH 247 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 161,180 Number of Sequences: 336 Number of extensions: 3051 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -