BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1361 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 27 2.0 SPBC31A8.01c |cwl1|rtn1, SPBC651.13c|reticulon-like protein|Schi... 27 2.6 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 27.5 bits (58), Expect = 2.0 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 313 REDYESREPNRP-FDSTCGERSINIMTYLHAVHARGARAED 194 R D SRE R DST E +++ Y A+H G R ED Sbjct: 792 RSDAASREILRAEADSTSDENLKDLLPYGFAIHHAGMRRED 832 >SPBC31A8.01c |cwl1|rtn1, SPBC651.13c|reticulon-like protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 27.1 bits (57), Expect = 2.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +1 Query: 7 FNNFF*YAFLVYRSLYIYNFLF 72 F FF FL Y+SL+++N LF Sbjct: 244 FIEFFLSGFLSYKSLFVWNVLF 265 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,443,105 Number of Sequences: 5004 Number of extensions: 45099 Number of successful extensions: 73 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -