BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1361 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58168| Best HMM Match : Podoplanin (HMM E-Value=1.1) 28 6.4 SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) 28 6.4 SB_21739| Best HMM Match : VWA (HMM E-Value=6.4e-24) 28 8.5 >SB_58168| Best HMM Match : Podoplanin (HMM E-Value=1.1) Length = 506 Score = 28.3 bits (60), Expect = 6.4 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -2 Query: 319 AAREDYESREPNRPFDSTCGERSINIMTYLHAV--HARGARAEDTARP 182 AA + + R RP DST R++ I T H V H +ARP Sbjct: 288 AAAQQTKDRTARRPGDSTSRSRTVQISTVSHVVSRHLNTRAPPISARP 335 >SB_25564| Best HMM Match : RVT_1 (HMM E-Value=0.049) Length = 588 Score = 28.3 bits (60), Expect = 6.4 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 106 IKYTCQIVNE*AIISLKEAQAFRYRRAEPYPQLGHPSRGPR 228 ++ T +V E I S+ + + EPY L HP + PR Sbjct: 537 LRRTLAVVCEKEIASIYFISTAEFIKPEPYDHLSHPIKNPR 577 >SB_21739| Best HMM Match : VWA (HMM E-Value=6.4e-24) Length = 220 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 256 SRHR*NQRVCLVPATRSLPWPRSF 327 +R+R + R L R+LPWPR+F Sbjct: 195 ARYRGHMRESLFTIQRTLPWPRNF 218 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,877,372 Number of Sequences: 59808 Number of extensions: 326597 Number of successful extensions: 629 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 629 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -