BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1361 (704 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17700.1 68416.m02259 cyclic nucleotide-binding transporter 1... 29 4.0 At4g10955.1 68417.m01782 lipase class 3 family protein contains ... 28 6.9 >At3g17700.1 68416.m02259 cyclic nucleotide-binding transporter 1 / CNBT1 (CNGC20) identical to cyclic nucleotide-binding transporter 1 (CNBT1) GI:8131898 from [Arabidopsis thaliana]; member of the cyclic nucleotide-gated channel (CNGC) family- see PMID:11500563 Length = 764 Score = 28.7 bits (61), Expect = 4.0 Identities = 20/44 (45%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = -1 Query: 491 LRIGQVG--RD--ATYAPSNYTRLGANIPTSIVTIIF*HETKNA 372 LR GQ+G D T PS Y R A IPTS V+ +F NA Sbjct: 126 LRSGQLGMCNDPYCTTCPSYYNRKAAQIPTSRVSALFDSTFHNA 169 >At4g10955.1 68417.m01782 lipase class 3 family protein contains Pfam profile PF01764: Lipase Length = 350 Score = 27.9 bits (59), Expect = 6.9 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +2 Query: 281 SVWFPRLVVFPGRAHLNVCDKHTGNFRELN 370 S WFPRL V PG HL C ++ G F N Sbjct: 252 SDWFPRLYVNPG-DHL--CSEYVGYFEHRN 278 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,319,346 Number of Sequences: 28952 Number of extensions: 224355 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1516419560 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -