BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1360 (798 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0431 + 3308001-3308124,3308209-3308366,3311285-3311794 29 5.7 02_01_0091 + 646299-649082 28 9.9 >11_01_0431 + 3308001-3308124,3308209-3308366,3311285-3311794 Length = 263 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +3 Query: 339 HNILNYSDTSIPIEKQIYEITHIKCLPGHSKNANYSHKKKKLDHFG 476 +++ + + + EK+++ + H L G AN + K L H+G Sbjct: 66 YHLKEWENNPVQNEKELFNLRHSSRLIGQDHKANADYFNKPLAHYG 111 >02_01_0091 + 646299-649082 Length = 927 Score = 27.9 bits (59), Expect = 9.9 Identities = 16/55 (29%), Positives = 26/55 (47%) Frame = +3 Query: 429 KNANYSHKKKKLDHFGIRGRLNFAFYVQKYYSMRTSIQQSKI*LCGNIKKAENCI 593 K+ N LDH A +VQ S+RT+++Q + LCG + A + + Sbjct: 754 KSNNQKSDSINLDHLPPYSFETQAVWVQIPVSVRTTMEQMEYQLCGGVHAASHAL 808 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,298,269 Number of Sequences: 37544 Number of extensions: 311696 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 513 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -