BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1360 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 3.6 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 8.3 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 24.6 bits (51), Expect = 3.6 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = +3 Query: 411 CLPGHSKNANYSHKKKKLDHFGIRGRLNFAFYVQKYY 521 CL G+ KN NY + D FG F Q Y+ Sbjct: 354 CLQGYGKNPNYGY--TSFDTFGWAFLSAFRLMTQDYW 388 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 682 QCNSNSVSTSN*HPRKGGGLIVYNKIMEKKMQFSAF 575 +CN V P GG+IVY + + + F A+ Sbjct: 473 RCNDLLVEELPLSPSAPGGMIVYRRSLTLSLFFKAY 508 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 766,610 Number of Sequences: 2352 Number of extensions: 13502 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -