BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1360 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81554-5|CAB04510.2| 401|Caenorhabditis elegans Hypothetical pr... 31 0.96 Z92972-1|CAB07483.1| 283|Caenorhabditis elegans Hypothetical pr... 29 3.9 U29244-10|AAC71091.2| 908|Caenorhabditis elegans Hypothetical p... 29 5.1 >Z81554-5|CAB04510.2| 401|Caenorhabditis elegans Hypothetical protein F57G4.8 protein. Length = 401 Score = 31.1 bits (67), Expect = 0.96 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +1 Query: 229 NSLTFCCLKEKYFSNQLYVFSVSFNLKRLSFLI*GHYII--Y*ITVTPAFQSKNKFMR 396 N+L FCC K+ + ++ Y S S + L H+II T A + KN FM+ Sbjct: 266 NTLQFCCAKKFFMDDETYKLSKSTGIDNFFHL--SHFIISVQEFTTRDAMKIKNIFMK 321 >Z92972-1|CAB07483.1| 283|Caenorhabditis elegans Hypothetical protein T19C9.1 protein. Length = 283 Score = 29.1 bits (62), Expect = 3.9 Identities = 24/74 (32%), Positives = 33/74 (44%), Gaps = 1/74 (1%) Frame = -1 Query: 624 LLFIIRLWKKKCNFPPFLYFHIIIFSTAEYSFSYCNIFVHKMQNSIYP*SQSGQVFFFCA 445 LL+ I + KK C P + +I I YSFS I + + I+P F Sbjct: 26 LLYSIFVSKKLCRKPDLVLIYIRISVDMVYSFSAFLIQAYYIARQIHP--------GFVM 77 Query: 444 NNLHFYCV-PANIL 406 N+ FY PAN+L Sbjct: 78 KNMSFYLAWPANLL 91 >U29244-10|AAC71091.2| 908|Caenorhabditis elegans Hypothetical protein ZK1248.10 protein. Length = 908 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -1 Query: 675 TVTACQRVISIHARAVGLLFIIRLWKKKCNFPPFLYFH 562 T C + I R++GL+ R W C+ P+LY++ Sbjct: 17 TSAICGYLHRIEVRSIGLITRRRYWFALCDSTPYLYWY 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,147,482 Number of Sequences: 27780 Number of extensions: 353894 Number of successful extensions: 684 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -