BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1358 (714 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 9.9 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 9.9 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 21.0 bits (42), Expect = 9.9 Identities = 9/38 (23%), Positives = 19/38 (50%) Frame = +2 Query: 32 NTGFIPLFSFNEIPCFDNVASPMIMGRLKTVSAMIETT 145 +T +P F++N P + P++ + + +ETT Sbjct: 92 STPIVPHFAYNHNPLTPPNSEPLVSPKSEKEEKDMETT 129 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 71 PCFDNVASPMIMGRLKTVSAMIETTTSVYPFSSQFFRC 184 P F + + + L A IE ++VY F+ +F C Sbjct: 372 PSFAQFSQEIGLASLGASDAEIEKLSTVYWFTVEFGLC 409 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,953 Number of Sequences: 336 Number of extensions: 3499 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -