BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1358 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_58206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 675 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -3 Query: 115 QSTHYHGTCNIIETWNLIKTKKWNEP 38 + T Y TCNI E + KT K EP Sbjct: 300 ERTEYQKTCNIEEEMQMYKTAKGQEP 325 >SB_41711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1662 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 205 ASRISMATPKKLTRKRVDRCGS 140 ASR S TPKKL ++ DRC + Sbjct: 63 ASRQSALTPKKLPVRKADRCNT 84 >SB_40727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1393 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 393 DTTTGTLTSWPLDGQYPYGDSYEHQYPLSIRL 298 DT TG+ T W L+ Y H YPL + + Sbjct: 1188 DTLTGSATQWCLERIIELKTFYGHVYPLLVHI 1219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,596,097 Number of Sequences: 59808 Number of extensions: 416427 Number of successful extensions: 858 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 805 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -