BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1358 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. 23 9.5 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 23 9.5 >DQ974163-1|ABJ52803.1| 595|Anopheles gambiae serpin 4B protein. Length = 595 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -3 Query: 472 VVGCVCKHL*ATIMIILPRSSNVLK 398 ++G KH +T+ +I+P +SN K Sbjct: 289 IIGIPYKHNVSTMYVIMPNNSNRAK 313 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 23.0 bits (47), Expect = 9.5 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +3 Query: 309 TVGTGAHRNHHK---DTAHPEAKRSRSQLWCQPFNT 407 TVGT H+ HH+ A P + S S + F+T Sbjct: 65 TVGTAQHQLHHQGHSPVASPHSALSLSPVSVSKFDT 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,718 Number of Sequences: 2352 Number of extensions: 14236 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -