BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1358 (714 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069178-1|AAL39323.1| 352|Drosophila melanogaster GH22719p pro... 30 3.6 AE013599-487|AAF59201.1| 352|Drosophila melanogaster CG1942-PA ... 30 3.6 AY075443-1|AAL68256.1| 352|Drosophila melanogaster RE04845p pro... 29 8.3 AE013599-486|AAF59202.1| 352|Drosophila melanogaster CG1941-PA ... 29 8.3 >AY069178-1|AAL39323.1| 352|Drosophila melanogaster GH22719p protein. Length = 352 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +2 Query: 17 VLILINTG--FIPLFSFNEIPCFDNVASP--MIMGRLKTVSAMIETTTSVYPFSSQFF 178 V + I TG +P FSF E+ FD VA+P ++ R + + + + P FF Sbjct: 227 VRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDFVKKLTGVSPLIPVGRGFF 284 >AE013599-487|AAF59201.1| 352|Drosophila melanogaster CG1942-PA protein. Length = 352 Score = 29.9 bits (64), Expect = 3.6 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 4/58 (6%) Frame = +2 Query: 17 VLILINTG--FIPLFSFNEIPCFDNVASP--MIMGRLKTVSAMIETTTSVYPFSSQFF 178 V + I TG +P FSF E+ FD VA+P ++ R + + + + P FF Sbjct: 227 VRMAIRTGSSIVPSFSFGEVDIFDQVANPPNSLLRRFQDFVKKLTGVSPLIPVGRGFF 284 >AY075443-1|AAL68256.1| 352|Drosophila melanogaster RE04845p protein. Length = 352 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +2 Query: 17 VLILINTG--FIPLFSFNEIPCFDNVASPMIMGRLKTVSAMIETTTSVYP 160 V + I TG +P FSF E+ D VA+P R++ ++ T + P Sbjct: 227 VKMAIRTGSSIVPTFSFGEVDILDQVANPP-NSRVRRFQDFVKRITGISP 275 >AE013599-486|AAF59202.1| 352|Drosophila melanogaster CG1941-PA protein. Length = 352 Score = 28.7 bits (61), Expect = 8.3 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +2 Query: 17 VLILINTG--FIPLFSFNEIPCFDNVASPMIMGRLKTVSAMIETTTSVYP 160 V + I TG +P FSF E+ D VA+P R++ ++ T + P Sbjct: 227 VKMAIRTGSSIVPTFSFGEVDILDQVANPP-NSRVRRFQDFVKRITGISP 275 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,793,844 Number of Sequences: 53049 Number of extensions: 617940 Number of successful extensions: 1342 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1339 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3170136354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -