BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1356 (828 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 3.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 3.8 AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 pr... 23 8.7 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 23 8.7 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 8.7 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 3.8 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 302 SVSRLEVRQFMTRCSKALFRYSSKE*DLPCISNESQHHH 418 SV +L+ R + S L Y + DLP SN HH Sbjct: 1930 SVGKLKQRGIVKLSSNELSNYLPNDSDLPASSNFILLHH 1968 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 3.8 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +2 Query: 302 SVSRLEVRQFMTRCSKALFRYSSKE*DLPCISNESQHHH 418 SV +L+ R + S L Y + DLP SN HH Sbjct: 1931 SVGKLKQRGIVKLSSNELSNYLPNDSDLPASSNFILLHH 1969 >AY193727-1|AAO24698.1| 492|Anopheles gambiae cytochrome P450 protein. Length = 492 Score = 23.4 bits (48), Expect = 8.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 337 RHELPYLQTTDTYFSIRNVAFLATSF 260 RH LP+L+ Y +IR VA SF Sbjct: 26 RHGLPHLKPEIPYGNIRTVAEKKESF 51 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 23.4 bits (48), Expect = 8.7 Identities = 19/62 (30%), Positives = 25/62 (40%), Gaps = 2/62 (3%) Frame = -1 Query: 504 TGIVLITVLFNITSQYMHYFMHHTALTAR**C*DSFEIQGRSY--SFEEYLNSALEQRVM 331 T +L++VLF+ S YM F H + C GR + EY L R Sbjct: 10 TAALLLSVLFSTGSCYMRDFAHKNEINEMRVC---IGTNGRMSVPANREYHYKNLRDRYT 66 Query: 330 NC 325 NC Sbjct: 67 NC 68 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.4 bits (48), Expect = 8.7 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 337 RHELPYLQTTDTYFSIRNVAFLATSF 260 RH LP+L+ Y +IR VA SF Sbjct: 26 RHGLPHLKPEIPYGNIRTVAEKKESF 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 723,415 Number of Sequences: 2352 Number of extensions: 12846 Number of successful extensions: 72 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 88150236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -