BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1356 (828 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY017307-1|AAG52948.1| 3389|Homo sapiens CUB and sushi multiple ... 31 6.7 AF333704-1|AAK73475.2| 3566|Homo sapiens CUB and sushi multiple ... 31 6.7 AB209502-1|BAD92739.1| 2966|Homo sapiens CUB and Sushi multiple ... 31 6.7 >AY017307-1|AAG52948.1| 3389|Homo sapiens CUB and sushi multiple domains protein 1 short form protein. Length = 3389 Score = 30.7 bits (66), Expect = 6.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 605 STIDYRCKLGCDCVSKNETRKCCLTLTRSVLLSRCITAKCEQ 730 ST+ +RC+ G + + TR C LT S + + CI C Q Sbjct: 3062 STVFFRCRKGYH-IQGSTTRTCLANLTWSGIQTECIPHACRQ 3102 >AF333704-1|AAK73475.2| 3566|Homo sapiens CUB and sushi multiple domains 1 protein protein. Length = 3566 Score = 30.7 bits (66), Expect = 6.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 605 STIDYRCKLGCDCVSKNETRKCCLTLTRSVLLSRCITAKCEQ 730 ST+ +RC+ G + + TR C LT S + + CI C Q Sbjct: 3239 STVFFRCRKGYH-IQGSTTRTCLANLTWSGIQTECIPHACRQ 3279 >AB209502-1|BAD92739.1| 2966|Homo sapiens CUB and Sushi multiple domains 1 variant protein. Length = 2966 Score = 30.7 bits (66), Expect = 6.7 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +2 Query: 605 STIDYRCKLGCDCVSKNETRKCCLTLTRSVLLSRCITAKCEQ 730 ST+ +RC+ G + + TR C LT S + + CI C Q Sbjct: 2654 STVFFRCRKGYH-IQGSTTRTCLANLTWSGIQTECIPHACRQ 2694 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,351,733 Number of Sequences: 237096 Number of extensions: 1730735 Number of successful extensions: 6529 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6529 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10370898348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -