BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1352 (786 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosacchar... 26 5.3 SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 26 5.3 SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizo... 26 5.3 >SPAC57A7.10c |sec21||coatomer gamma subunit Sec21 |Schizosaccharomyces pombe|chr 1|||Manual Length = 905 Score = 26.2 bits (55), Expect = 5.3 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 520 WLQNRSDLANLEMSYHVVTLIALWDYRYVPTLS 422 WL+++ D+ NLE++ ++V L + D P +S Sbjct: 278 WLKSKGDMVNLEVARNMVRLKNISDDDLQPVVS 310 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 26.2 bits (55), Expect = 5.3 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 3/41 (7%) Frame = -3 Query: 781 FHRRSLTTTSIKNRLSIKNRMFQNERTKI---TLSLVGSID 668 FHR S+T+ SIK+R ++ + + R I LSL G D Sbjct: 624 FHRSSVTSASIKSREAVLSAGNSSRRASIFLDQLSLHGDTD 664 >SPCC1739.11c |cdc11||SIN component scaffold protein Cdc11|Schizosaccharomyces pombe|chr 3|||Manual Length = 1045 Score = 26.2 bits (55), Expect = 5.3 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 569 SISIQMHLEDQSWADAVAPEQKRSSQFRDVLPRRHIDRFVGLS-VCPN 429 S+S Q ++ S + P KR Q + RRH+D +GLS +CP+ Sbjct: 582 SVSRQSIIQILSDVEPYEPFWKRIIQLD--ISRRHLDSLIGLSELCPS 627 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,685,514 Number of Sequences: 5004 Number of extensions: 51274 Number of successful extensions: 110 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -