BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1350 (828 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025452-1|AAB70944.1| 411|Caenorhabditis elegans C-type lectin... 29 5.4 AF025450-9|AAB70938.2| 409|Caenorhabditis elegans C-type lectin... 29 5.4 >AF025452-1|AAB70944.1| 411|Caenorhabditis elegans C-type lectin protein 2 protein. Length = 411 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 620 IGKRKNNYYLFSIIFFGNLCLWDPISNEILQYHNHS 513 IG + ++ F NLCLWD S Y N S Sbjct: 72 IGSQVETVWMGLFCFNNNLCLWDDNSGSTAAYDNFS 107 >AF025450-9|AAB70938.2| 409|Caenorhabditis elegans C-type lectin protein 3 protein. Length = 409 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = -2 Query: 620 IGKRKNNYYLFSIIFFGNLCLWDPISNEILQYHNHS 513 IG + ++ F NLCLWD S Y N S Sbjct: 73 IGSQVETVWMGLFCFNNNLCLWDDNSGSTAAYDNFS 108 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,030,290 Number of Sequences: 27780 Number of extensions: 380552 Number of successful extensions: 946 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 946 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2050970610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -