BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1349 (677 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 30 0.077 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 25 2.9 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 24 5.1 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.9 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 29.9 bits (64), Expect = 0.077 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 438 KAQNAEKPKSANT*CFLVLIRGHLLKEIFPDNKS 337 K + A KP + + CF L RGH+++E N+S Sbjct: 222 KVREAPKPSAESRRCFRCLERGHMVRECQGTNRS 255 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 2/31 (6%) Frame = -2 Query: 619 RTPHQRPCGTVGKRRKRRPPKQIW--RRSRM 533 R RP T RR RPP W RRSR+ Sbjct: 11 RASPSRPILTTRGRRWPRPPTSCWPSRRSRL 41 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 23.8 bits (49), Expect = 5.1 Identities = 13/45 (28%), Positives = 18/45 (40%) Frame = -3 Query: 444 YKKAQNAEKPKSANT*CFLVLIRGHLLKEIFPDNKSHGGNECNDR 310 Y A K T CF L RGH+ +++S C D+ Sbjct: 450 YCSVHEAPKVSGQLTRCFRCLERGHIAATCTGEDRSKRCLRCGDQ 494 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 8.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 62 DCDTSAVSRASMTQYNLT 9 DC T+ + +TQYN T Sbjct: 951 DCYTTVIPHTVLTQYNYT 968 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 778,255 Number of Sequences: 2352 Number of extensions: 16713 Number of successful extensions: 24 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68159265 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -