BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1347X (455 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.0 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 22 3.1 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 4.1 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 21 5.5 AM269505-4|CAK30051.1| 23|Tribolium castaneum mlpt peptide 4 p... 21 5.5 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.4 bits (48), Expect = 1.0 Identities = 13/53 (24%), Positives = 21/53 (39%) Frame = +2 Query: 296 HYGDLSKSREQVYAASRLAELHDAVLTWPKGYDTEVGERGLKLSGGEKQRVGI 454 +YG + Q Y + +H A P G+ T+V KL + G+ Sbjct: 96 YYGPQQQMDGQEYRPDSPSSMHMANTAAPNGHQTQVVYASCKLQAAAVTQNGV 148 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.8 bits (44), Expect = 3.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 275 DTIFHNLHYGDLSKSREQVYAASRLAELHDAV 370 DT+ NL +E Y RLA D+V Sbjct: 22 DTLAKNLGINSSFVHKEHCYVLVRLARFRDSV 53 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 4.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 137 NGPTVVPILRTAVREH 184 + PT PI+R A+R+H Sbjct: 97 SAPTGPPIVRCALRKH 112 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 21.0 bits (42), Expect = 5.5 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -1 Query: 452 CPRAASRPRTASGRARRPPYHSPW 381 CP+A SRP G R P+ Sbjct: 13 CPKAFSRPWLLQGHIRTHTGEKPF 36 >AM269505-4|CAK30051.1| 23|Tribolium castaneum mlpt peptide 4 protein. Length = 23 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 434 RPRTASGRARR 402 RP T+SGR RR Sbjct: 11 RPETSSGRRRR 21 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,016 Number of Sequences: 336 Number of extensions: 1709 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10406187 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -