BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1345 (806 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 24 1.2 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 24 1.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 3.8 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 5.0 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 377 KFWRGMKNTLFVFRIGELICFINFILHGFLAKKIQICI 264 +F + N F +G L C + F L G + K IC+ Sbjct: 67 RFVYAVYNIFGAFVMG-LFCILKFALDGLMLDKTGICV 103 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 23.8 bits (49), Expect = 1.6 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +1 Query: 211 SLSSFIIPTPVIC*TYHKIQICIFLAKNPCNIKLMKQIN 327 SLS FIIP +I Y I I I+ IK K +N Sbjct: 190 SLSLFIIPASIIATCYAIIIITIWSKNAKGFIKNTKAVN 228 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.8 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -2 Query: 760 IVVKVYFRMCTFFVFMKCLKALC 692 I+ V+F +CT++ + + LC Sbjct: 90 IIFTVHFLLCTYYFYYAFIILLC 112 Score = 21.4 bits (43), Expect = 8.7 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = -3 Query: 270 LYFMICLTYDWCRY 229 L+F++C+ Y +C + Sbjct: 140 LFFLLCIYYFYCAF 153 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 5.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 463 SLYSCALEWIQLAFDINTLQIVRRN 389 SL SC WI LAF+ +++ R+ Sbjct: 309 SLNSCVNPWIYLAFNRELPRLLLRH 333 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,904 Number of Sequences: 336 Number of extensions: 4073 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21999028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -