BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1345 (806 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 29 3.4 SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) 29 4.4 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/67 (26%), Positives = 27/67 (40%) Frame = +1 Query: 283 LAKNPCNIKLMKQINSPILNTNKVFFIPLQNFK*DYFFSQFEEYLCQRQAVSTLTHMNRA 462 L ++ I L I PI T K+F P + K EE+L ++ T N+ Sbjct: 268 LVRDTSRINLFSAIRHPIKTTKKLFVNPEDSLKGIILKPNLEEHLSSISIATSNTKRNKG 327 Query: 463 RVTNNVF 483 N +F Sbjct: 328 MYRNLLF 334 >SB_25577| Best HMM Match : Mab-21 (HMM E-Value=1e-05) Length = 492 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/40 (32%), Positives = 24/40 (60%), Gaps = 5/40 (12%) Frame = -1 Query: 779 WKMSFDNCSKSLFSHV-----HLLCLYEMLEGVVWEEELT 675 W++SF N K+LF+H+ H C++ +G+ ++E T Sbjct: 371 WRLSFSNAEKTLFAHMTELMRHCFCVF---KGIYYQELTT 407 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,543,326 Number of Sequences: 59808 Number of extensions: 443656 Number of successful extensions: 958 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 863 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -