BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1344X (315 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY128477-1|AAM75070.1| 939|Drosophila melanogaster RE39339p pro... 42 1e-04 AE014298-628|AAF45943.3| 939|Drosophila melanogaster CG3626-PA ... 42 1e-04 AY119481-1|AAM50135.1| 1288|Drosophila melanogaster GH07148p pro... 29 1.3 AE014298-1522|AAF47973.2| 1288|Drosophila melanogaster CG1582-PA... 29 1.3 >AY128477-1|AAM75070.1| 939|Drosophila melanogaster RE39339p protein. Length = 939 Score = 42.3 bits (95), Expect = 1e-04 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 125 RVGAGSRWHSSGLGGAFKPTLAQVRLAQSSIRLLKELEARGRPKG 259 RVG W + GL G F+P+ +++LA+ SI L+K L G P G Sbjct: 103 RVGGELPWTACGLAGRFEPSYTELKLAEYSIDLIKRLAENGLPTG 147 >AE014298-628|AAF45943.3| 939|Drosophila melanogaster CG3626-PA protein. Length = 939 Score = 42.3 bits (95), Expect = 1e-04 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 125 RVGAGSRWHSSGLGGAFKPTLAQVRLAQSSIRLLKELEARGRPKG 259 RVG W + GL G F+P+ +++LA+ SI L+K L G P G Sbjct: 103 RVGGELPWTACGLAGRFEPSYTELKLAEYSIDLIKRLAENGLPTG 147 >AY119481-1|AAM50135.1| 1288|Drosophila melanogaster GH07148p protein. Length = 1288 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 182 TLAQVRLAQSSIRLLKELEARGRPKGGNNVVHYYWQEQDT 301 TL Q+ + + + + + RGR GG+ V H YWQ++ T Sbjct: 59 TLRQIHGPEFQLDDISKYKDRGR--GGHGVKHSYWQDRGT 96 >AE014298-1522|AAF47973.2| 1288|Drosophila melanogaster CG1582-PA protein. Length = 1288 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 182 TLAQVRLAQSSIRLLKELEARGRPKGGNNVVHYYWQEQDT 301 TL Q+ + + + + + RGR GG+ V H YWQ++ T Sbjct: 59 TLRQIHGPEFQLDDISKYKDRGR--GGHGVKHSYWQDRGT 96 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,723,714 Number of Sequences: 53049 Number of extensions: 229174 Number of successful extensions: 414 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 631882260 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -