BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1344X (315 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43070.1 68415.m05344 protease-associated (PA) domain-contain... 27 3.5 >At2g43070.1 68415.m05344 protease-associated (PA) domain-containing protein contains protease associated (PA) domain, Pfam:PF02225 Length = 540 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 93 F*FSLIFLYCEEWVQGVAGIHQALVEHSSQHLLR*GLPSPQLGFLRSLRLV 245 F + L +C +QG+ I A++ +HL R + P LG + L L+ Sbjct: 278 FVWVLTIFFCIGGMQGMHNIIMAVILRKCRHLARKSVKLPLLGTMSVLSLL 328 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,526,669 Number of Sequences: 28952 Number of extensions: 104324 Number of successful extensions: 207 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 204 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 207 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 330493944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -