BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1343 (764 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP25A2.03 |||THO complex subunit |Schizosaccharomyces pombe|ch... 27 2.9 SPAC1639.01c ||SPAC806.09c|GNS1/SUR4 family protein|Schizosaccha... 26 6.8 SPAC8F11.08c |||esterase/lipase|Schizosaccharomyces pombe|chr 1|... 25 9.0 >SPCP25A2.03 |||THO complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 752 Score = 27.1 bits (57), Expect = 2.9 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -2 Query: 328 YFATARKGVVQNVVAEKLDCFVPWQHCQGRSCSNVESPTLE 206 + TAR G VQ + E + W+ +G C ++E P ++ Sbjct: 376 FLHTARCGSVQRTIKEIIHIEGNWKLWKGLGCPSLEKPLVD 416 >SPAC1639.01c ||SPAC806.09c|GNS1/SUR4 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 328 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 311 KGCSAKCGCRKVGLFCSLATLSRPIML 231 K C C + FC LAT+S ++L Sbjct: 231 KACMGHCSGHPLAAFCGLATISSYLVL 257 >SPAC8F11.08c |||esterase/lipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 376 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/22 (40%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +1 Query: 523 FYYAYFS-RKMCIATYLSKWFF 585 +YY + S R + AT++++WFF Sbjct: 346 YYYEFTSPRTISTATFIARWFF 367 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,725,939 Number of Sequences: 5004 Number of extensions: 52301 Number of successful extensions: 132 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 132 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -