BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1343 (764 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0004 + 39265-39440,39545-39652,41955-43528,43650-43996,440... 28 7.1 >08_01_0004 + 39265-39440,39545-39652,41955-43528,43650-43996, 44090-44322,45308-45412,45531-45705,46443-46658 Length = 977 Score = 28.3 bits (60), Expect = 7.1 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 319 TARKGVVQNVVAEKLDC-FVPWQHCQGRSCSNVESPTLEDSFDTDQES 179 + R+ + V+ + C F P+QH G S S+ E + EDS D S Sbjct: 92 SVRRCRIFTVIPYNICCDFKPFQHTDGSSHSSSELASPEDSLDLSSSS 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,258,212 Number of Sequences: 37544 Number of extensions: 318146 Number of successful extensions: 799 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2051430072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -