BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1343 (764 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical pr... 30 2.1 Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical p... 30 2.1 AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator comp... 30 2.1 AF025450-3|AAB70932.1| 331|Caenorhabditis elegans Hypothetical ... 29 2.7 U53335-6|AAA96171.2| 518|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical pr... 28 6.3 >Z68314-9|CAA92667.2| 2862|Caenorhabditis elegans Hypothetical protein K08F8.6 protein. Length = 2862 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 365 LLPPAPEKLLNTIFCNCKKGCSAKCGCR 282 LLPP EK LN F K GC CR Sbjct: 512 LLPPLKEKFLNWKFTAKKYGCRGDVSCR 539 >Z66497-12|CAA91289.2| 2862|Caenorhabditis elegans Hypothetical protein K08F8.6 protein. Length = 2862 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 365 LLPPAPEKLLNTIFCNCKKGCSAKCGCR 282 LLPP EK LN F K GC CR Sbjct: 512 LLPPLKEKFLNWKFTAKKYGCRGDVSCR 539 >AB223006-1|BAE16563.1| 2862|Caenorhabditis elegans Mediator complex subunit Med13 protein. Length = 2862 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/28 (50%), Positives = 14/28 (50%) Frame = -1 Query: 365 LLPPAPEKLLNTIFCNCKKGCSAKCGCR 282 LLPP EK LN F K GC CR Sbjct: 512 LLPPLKEKFLNWKFTAKKYGCRGDVSCR 539 >AF025450-3|AAB70932.1| 331|Caenorhabditis elegans Hypothetical protein C41H7.4 protein. Length = 331 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +3 Query: 210 RVGDSTFEHDRP*QCCQGTKQSNFSATT 293 R GDS F H P Q G+ SNFS+ T Sbjct: 213 RGGDSYFGHGPPPQMVMGSSASNFSSAT 240 >U53335-6|AAA96171.2| 518|Caenorhabditis elegans Hypothetical protein C55C3.5 protein. Length = 518 Score = 29.1 bits (62), Expect = 3.6 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -1 Query: 437 LGNQLDPKDWGWKLIDNTLEPVQTLLPPAPEKLLNTIFCNC 315 L LD DW ++ +D + ++PP + L+T+ C Sbjct: 289 LNEILDQIDWNFEWMDEQIPVTSPIIPPDSREFLSTLCSEC 329 >Z83217-4|CAB05683.2| 1178|Caenorhabditis elegans Hypothetical protein C10C6.6 protein. Length = 1178 Score = 28.3 bits (60), Expect = 6.3 Identities = 15/45 (33%), Positives = 19/45 (42%) Frame = -1 Query: 437 LGNQLDPKDWGWKLIDNTLEPVQTLLPPAPEKLLNTIFCNCKKGC 303 L D DW WK +D T+E L P K+ F N + C Sbjct: 726 LDEPADGVDWMWKSVDGTIE--LPLKPETKNKMERKAFFNSHEFC 768 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,307,008 Number of Sequences: 27780 Number of extensions: 299671 Number of successful extensions: 864 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -