BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1340 (746 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O77332 Cluster: Putative uncharacterized protein MAL3P3... 36 1.4 UniRef50_P58145 Cluster: Ribosomal operon-associated A protein; ... 33 5.6 >UniRef50_O77332 Cluster: Putative uncharacterized protein MAL3P3.16; n=3; Plasmodium|Rep: Putative uncharacterized protein MAL3P3.16 - Plasmodium falciparum (isolate 3D7) Length = 1673 Score = 35.5 bits (78), Expect = 1.4 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +2 Query: 404 YLIKIFLHTYILDKTN*LKYFFYYSTFFFNIRYSL 508 Y K H+ + TN LKY FY+ F+FN+ YSL Sbjct: 173 YFDKYIYHSKNIPMTN-LKYLFYFHLFYFNMNYSL 206 >UniRef50_P58145 Cluster: Ribosomal operon-associated A protein; n=1; Euglena longa|Rep: Ribosomal operon-associated A protein - Astasia longa (Euglenophycean alga) Length = 519 Score = 33.5 bits (73), Expect = 5.6 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 350 KEFFRIEYRQRNGEQKQNYLIKIFLHTYILDKTN*LKYFFYYSTFFFN 493 K F ++ Y N K NY+ K +L+ + N LKYF + F FN Sbjct: 167 KNFMKLYYFTINFNNKFNYMNKKWLYKNLTFNINFLKYFLKLNNFIFN 214 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,521,878 Number of Sequences: 1657284 Number of extensions: 10086130 Number of successful extensions: 19309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19302 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 61323318355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -