BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1338X (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0387 - 8016399-8016575,8016661-8016788,8017073-8017214,801... 109 1e-24 10_02_0148 - 5859664-5859828,5859916-5860043,5860310-5860451,586... 64 6e-19 02_05_1150 + 34481965-34482076,34482174-34482268,34482380-344824... 49 2e-06 01_07_0052 - 40767252-40767347,40767455-40767562,40767689-407678... 45 4e-05 01_07_0050 - 40751994-40752086,40752193-40752300,40752501-407526... 45 4e-05 10_08_0921 + 21586034-21586229,21586464-21586576,21586768-215868... 44 5e-05 01_07_0051 - 40759529-40759624,40759728-40759835,40759972-407601... 44 9e-05 11_04_0455 + 17903921-17904046,17904149-17904214,17905028-179051... 43 1e-04 08_02_0005 + 11190901-11191896 30 0.90 11_06_0272 + 21806681-21806908,21806991-21807233,21807318-218074... 29 2.1 04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305,962... 28 3.6 12_02_1003 - 25183468-25184010,25184295-25184551,25184795-251849... 28 4.8 11_03_0063 + 9515666-9516656,9517503-9518599 28 4.8 09_01_0073 - 1057560-1058043,1058199-1058385,1058754-1059062,105... 28 4.8 02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 28 4.8 01_01_0100 - 755894-756662,757086-757598,758718-761050 28 4.8 11_08_0020 - 27711598-27711669,27711854-27711970,27712088-277122... 27 6.3 11_08_0036 + 27850822-27850920,27851773-27851949,27852040-278522... 27 8.4 11_02_0104 + 8329231-8329902 27 8.4 11_02_0097 - 8285425-8286090 27 8.4 11_02_0094 - 8250460-8250819 27 8.4 11_02_0093 - 8238947-8239615 27 8.4 03_01_0466 - 3605909-3606073,3606689-3607004,3607184-3607689 27 8.4 >03_02_0387 - 8016399-8016575,8016661-8016788,8017073-8017214, 8017301-8017396,8017572-8017712,8017857-8018031, 8018443-8018575,8018661-8018733,8018807-8018900, 8019890-8019981,8020091-8020185,8020267-8020378 Length = 485 Score = 109 bits (262), Expect = 1e-24 Identities = 48/80 (60%), Positives = 62/80 (77%) Frame = +2 Query: 257 LNFGSTSFLSLDKNETIIDSALKAMEKYGVGSCGPRGFYGTIDVHLELEERLAKFLEVEE 436 +NF S ++L L NE IIDS + ++EKYGVGSCGPRGFYGTIDVHL+ E ++AKFL + Sbjct: 114 INFASANYLGLIGNEKIIDSCVGSLEKYGVGSCGPRGFYGTIDVHLDCEAKIAKFLGTPD 173 Query: 437 TCVYSYGFSTIASAIPSYAK 496 + +YSYG STI S IP++ K Sbjct: 174 SILYSYGISTIFSVIPAFCK 193 >10_02_0148 - 5859664-5859828,5859916-5860043,5860310-5860451, 5860548-5860643,5860836-5860976,5861799-5861973, 5862416-5862702,5862777-5862870,5863244-5863335, 5863459-5863553,5863648-5863759 Length = 508 Score = 63.7 bits (148), Expect(2) = 6e-19 Identities = 28/46 (60%), Positives = 35/46 (76%) Frame = +2 Query: 257 LNFGSTSFLSLDKNETIIDSALKAMEKYGVGSCGPRGFYGTIDVHL 394 +NF S ++L L NE IIDS + ++EKYGVGSCGPR FYGTI +L Sbjct: 114 VNFASANYLGLIGNEKIIDSCVGSVEKYGVGSCGPRSFYGTIGSYL 159 Score = 47.6 bits (108), Expect(2) = 6e-19 Identities = 19/38 (50%), Positives = 28/38 (73%) Frame = +2 Query: 383 DVHLELEERLAKFLEVEETCVYSYGFSTIASAIPSYAK 496 DVHL+ E ++A FL +++ +YSYG STI S IP++ K Sbjct: 183 DVHLDCESKIANFLGTQDSILYSYGISTIFSVIPAFCK 220 >02_05_1150 + 34481965-34482076,34482174-34482268,34482380-34482471, 34482878-34482971,34483191-34483354,34483755-34483929, 34484017-34484157,34484357-34484452,34484549-34484690, 34484953-34485080,34485179-34485343 Length = 467 Score = 49.2 bits (112), Expect = 2e-06 Identities = 20/38 (52%), Positives = 29/38 (76%) Frame = +2 Query: 383 DVHLELEERLAKFLEVEETCVYSYGFSTIASAIPSYAK 496 DVHL+ E ++AKFL +++ +YSYG STI S IP++ K Sbjct: 142 DVHLDCETKIAKFLGTQDSILYSYGISTIFSVIPAFCK 179 >01_07_0052 - 40767252-40767347,40767455-40767562,40767689-40767855, 40767930-40768056,40768138-40768299,40768467-40768630, 40768722-40768815,40768892-40769016,40769110-40769255, 40769361-40769449,40769564-40769608,40770165-40770230, 40770332-40770457 Length = 504 Score = 44.8 bits (101), Expect = 4e-05 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +2 Query: 251 KFLNFGSTSFLSLDK-NETIIDSALKAMEKYGVGSCGPRGFYGTIDVHLELEERLAKFLE 427 K LN GS ++L +E +++++KY +C R G +H+ELEE +A+F+ Sbjct: 116 KCLNLGSYNYLGFAAADEYCTPRVIESLKKYSASTCSVRVDGGNTKLHVELEELVARFVG 175 Query: 428 VEETCVYSYGFSTIASAIPS 487 ++ G+ T ++ IP+ Sbjct: 176 KPAAILFGMGYVTNSAIIPA 195 >01_07_0050 - 40751994-40752086,40752193-40752300,40752501-40752667, 40752756-40752882,40752984-40753145,40753674-40753837, 40753931-40754024,40754160-40754284,40754387-40754532, 40754676-40754764,40755524-40755589,40755990-40756148 Length = 499 Score = 44.8 bits (101), Expect = 4e-05 Identities = 22/80 (27%), Positives = 43/80 (53%), Gaps = 1/80 (1%) Frame = +2 Query: 251 KFLNFGSTSFLSLDK-NETIIDSALKAMEKYGVGSCGPRGFYGTIDVHLELEERLAKFLE 427 K LN S ++L +E +++++KY +C R G +H+ELEE +A+F+ Sbjct: 112 KCLNLASFNYLGFAAADEYCTPRVIESLKKYSASTCSSRVDGGNTQLHIELEELVARFVR 171 Query: 428 VEETCVYSYGFSTIASAIPS 487 + + G++T ++ IP+ Sbjct: 172 KPSAILLAMGYATNSAIIPA 191 >10_08_0921 + 21586034-21586229,21586464-21586576,21586768-21586875, 21586967-21587205,21587301-21587399,21587448-21587535, 21587617-21587750,21588274-21588362,21588718-21588751, 21588830-21588898,21589216-21589339 Length = 430 Score = 44.4 bits (100), Expect = 5e-05 Identities = 24/84 (28%), Positives = 39/84 (46%) Frame = +2 Query: 212 GSRGTSNNGNIK*KFLNFGSTSFLSLDKNETIIDSALKAMEKYGVGSCGPRGFYGTIDVH 391 G G+ + K + F ++ L + I +A+KA E+YG+G G G H Sbjct: 66 GGEGSGQEEKVDEKLILFSGNDYMGLSSHPAIRHAAVKAAEEYGMGPRGSALICGYTTYH 125 Query: 392 LELEERLAKFLEVEETCVYSYGFS 463 +EE LA+ + E+ + GFS Sbjct: 126 KMVEESLAELKKKEDCLLCPTGFS 149 >01_07_0051 - 40759529-40759624,40759728-40759835,40759972-40760138, 40760670-40760796,40760885-40761046,40761235-40761398, 40761561-40761654,40761736-40761860,40762304-40762449, 40762796-40762884,40763453-40763518,40763824-40763973 Length = 497 Score = 43.6 bits (98), Expect = 9e-05 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +2 Query: 257 LNFGSTSFLSLDK-NETIIDSALKAMEKYGVGSCGPRGFYGTIDVHLELEERLAKFLEVE 433 LN GS ++L +E +++++KY +C R G +H+ELEE +A+F+ Sbjct: 111 LNLGSYNYLGFAAADEYCTPRVIESLKKYSASTCSVRVDGGNTKLHVELEELVARFVGKP 170 Query: 434 ETCVYSYGFSTIASAIPS 487 ++ G+ T ++ IP+ Sbjct: 171 AAILFGMGYVTNSAIIPA 188 >11_04_0455 + 17903921-17904046,17904149-17904214,17905028-17905116, 17905513-17905658,17905743-17905867,17905964-17906057, 17906144-17906307,17906449-17906610,17906683-17906809, 17906854-17906862,17906912-17907078,17907113-17907307, 17907398-17907490 Length = 520 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 1/77 (1%) Frame = +2 Query: 257 LNFGSTSFLSLDK-NETIIDSALKAMEKYGVGSCGPRGFYGTIDVHLELEERLAKFLEVE 433 LN GS ++L +E +++++KY +C R GT +H ELEE +A+F+ Sbjct: 103 LNLGSYNYLGFAAADEYCTPLVIESLKKYSPSTCSVRVDGGTTKLHTELEELVARFVGKP 162 Query: 434 ETCVYSYGFSTIASAIP 484 ++ G+ T ++ IP Sbjct: 163 AAILFGMGYVTNSAIIP 179 >08_02_0005 + 11190901-11191896 Length = 331 Score = 30.3 bits (65), Expect = 0.90 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK +VE+ + +EE L +G + E+ Sbjct: 185 PIEATPKDIVEFKMHIEELLKLGAIRES 212 >11_06_0272 + 21806681-21806908,21806991-21807233,21807318-21807444, 21807822-21808036 Length = 270 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = -1 Query: 366 PLGPHEPTPYFSIAFKALSMIVSFLSKDKKLVEPKFKNFHLMFPLLEVPRLPHHTRP 196 PL P E T + F+ + ++ DK V+ K L P LEVPR+P + RP Sbjct: 182 PLPPVELTATLAHKFEIIGTSSIKITFDKTTVKTKGNLSQL--PPLEVPRIPDNLRP 236 >04_03_0024 - 9623178-9624001,9624502-9624678,9625144-9625305, 9625520-9626032,9626801-9629153 Length = 1342 Score = 28.3 bits (60), Expect = 3.6 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = +3 Query: 120 LWSKKRTRSHVLRSNEK--PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 L S++R + L+ K PIE PK + E+ + +EE L +G + E+ Sbjct: 944 LESEERINEYELKYIIKTSPIEATPKDIEEFKMHIEELLKLGAIRES 990 >12_02_1003 - 25183468-25184010,25184295-25184551,25184795-25184971, 25185438-25185905,25186720-25186730,25187589-25187599 Length = 488 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK + E+ + +EE L +G + E+ Sbjct: 117 PIEATPKDIEEFKMHIEELLKLGAIRES 144 >11_03_0063 + 9515666-9516656,9517503-9518599 Length = 695 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK + E+ + +EE L +G + E+ Sbjct: 580 PIEATPKDIEEFKMHIEELLKLGAIRES 607 >09_01_0073 - 1057560-1058043,1058199-1058385,1058754-1059062, 1059427-1060269,1061572-1062552,1063189-1063516 Length = 1043 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK + E+ + +EE L +G + E+ Sbjct: 637 PIEATPKDIEEFKMHIEELLKLGAIRES 664 >02_02_0305 + 8786599-8787184,8788613-8790001,8790370-8791196 Length = 933 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK + E+ + +EE L +G + E+ Sbjct: 354 PIEATPKDIEEFKMHIEELLKLGAIRES 381 >01_01_0100 - 755894-756662,757086-757598,758718-761050 Length = 1204 Score = 27.9 bits (59), Expect = 4.8 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 171 PIEWNPKPLVEYDVEVEEPLIMGTLNEN 254 PIE PK + E+ + +EE L +G + E+ Sbjct: 917 PIEATPKDIEEFKMHIEELLKLGAIRES 944 >11_08_0020 - 27711598-27711669,27711854-27711970,27712088-27712204, 27712482-27712572,27712770-27712851,27712926-27713039, 27713155-27713206,27713321-27713563,27713654-27713830, 27714672-27714770 Length = 387 Score = 27.5 bits (58), Expect = 6.3 Identities = 15/60 (25%), Positives = 24/60 (40%) Frame = -1 Query: 369 KPLGPHEPTPYFSIAFKALSMIVSFLSKDKKLVEPKFKNFHLMFPLLEVPRLPHHTRPMV 190 +P PH+ Y SI + L +SF +E + +F E P P P++ Sbjct: 108 EPFVPHDQEYYLSIVSERLGSTISFSECGGIEIEENWDKVKTIFLSTEKPMTPDACAPLI 167 >11_08_0036 + 27850822-27850920,27851773-27851949,27852040-27852282, 27852397-27852448,27852560-27852674,27852749-27852830, 27853023-27853118,27853212-27853313,27853397-27853513, 27853631-27853747,27853933-27854004 Length = 423 Score = 27.1 bits (57), Expect = 8.4 Identities = 15/60 (25%), Positives = 24/60 (40%) Frame = -1 Query: 369 KPLGPHEPTPYFSIAFKALSMIVSFLSKDKKLVEPKFKNFHLMFPLLEVPRLPHHTRPMV 190 +P PH+ Y SI + L +SF +E + +F E P P P++ Sbjct: 108 EPFVPHDQEYYLSIVSERLGSTISFSECGGIEIEENWDKVKTIFLPTEKPMTPDACAPLI 167 >11_02_0104 + 8329231-8329902 Length = 223 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 391 MHIYSAIKASRSTRAYTILFHSLQSAVYDCFIFIQ 287 +++ + + R+Y FH A Y CF FI+ Sbjct: 105 VNLQPCVPPTNEVRSYATSFHGTGKAEYRCFTFIR 139 >11_02_0097 - 8285425-8286090 Length = 221 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 391 MHIYSAIKASRSTRAYTILFHSLQSAVYDCFIFIQ 287 +++ + + R+Y FH A Y CF FI+ Sbjct: 104 VNLQPCVPPTNKVRSYATSFHGTGKAEYRCFTFIR 138 >11_02_0094 - 8250460-8250819 Length = 119 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 391 MHIYSAIKASRSTRAYTILFHSLQSAVYDCFIFIQ 287 +++ + + R+Y FH A Y CF FI+ Sbjct: 2 VNLQPCVPPTNEVRSYATSFHGTGKAEYRCFTFIR 36 >11_02_0093 - 8238947-8239615 Length = 222 Score = 27.1 bits (57), Expect = 8.4 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 373 IKASRSTRAYTILFHSLQSAVYDCFIFIQ 287 + + R Y FH + A Y CF FI+ Sbjct: 111 VPPTNEVRCYATSFHGTRKAEYRCFTFIR 139 >03_01_0466 - 3605909-3606073,3606689-3607004,3607184-3607689 Length = 328 Score = 27.1 bits (57), Expect = 8.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 222 PRLPHHTRPMVLGSTQLAS 166 P LP H RP+ L ST +AS Sbjct: 13 PSLPSHRRPLFLPSTSIAS 31 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,650,138 Number of Sequences: 37544 Number of extensions: 279348 Number of successful extensions: 755 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -