BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1333 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 26 5.0 SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|ch... 26 6.6 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 26.2 bits (55), Expect = 5.0 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 169 VNTSPNKSNASQNLQLDRNRDPMRRYRTKLS 77 +N PN + +LQ+D N+ P R + +LS Sbjct: 317 INVKPNSTTPHASLQIDENK-PTTRIQVRLS 346 >SPCC1322.03 |||TRP-like ion channel|Schizosaccharomyces pombe|chr 3|||Manual Length = 862 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 686 TFSFLLYSMLRIQFLLLLTTKAYIS 612 T+SF+ S++R+ FL T AY+S Sbjct: 370 TWSFIAGSLIRLYFLTYFPTVAYMS 394 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,622,957 Number of Sequences: 5004 Number of extensions: 47236 Number of successful extensions: 117 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -