BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1333 (750 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0966 - 24906361-24906958,24907084-24907250,24907403-249076... 28 6.9 >12_02_0966 - 24906361-24906958,24907084-24907250,24907403-24907650, 24907824-24908001,24908196-24908372,24908459-24908563, 24908633-24908770,24909757-24910836 Length = 896 Score = 28.3 bits (60), Expect = 6.9 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = -3 Query: 172 GVNTSPNKSNASQNLQLDRNR-DPMRRYRTKLSGLWNKIQYKQIAILNPNISFG 14 G SP + Q Q ++ P + K+SG W K +K I++PN++ G Sbjct: 323 GTKLSPEELVMLQGCQCPPSKLRPGFYWYDKVSGFWGKEGHKPHCIISPNLNVG 376 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,304,856 Number of Sequences: 37544 Number of extensions: 226155 Number of successful extensions: 430 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1992480932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -