BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1333 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 9.3 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 9.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 9.3 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 21 9.3 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 583 TVVNTIFKCRLIYALVVSNSKNCILNIEYKRNENVNVL 696 T+ + + CR +YA+ V+N++ +L +E N+L Sbjct: 455 TIEDLLHFCRQMYAMKVNNAEYALLTAIVIFSERPNLL 492 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 9.3 Identities = 12/29 (41%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -3 Query: 190 QLGLREGVNT-SPNKSNASQNLQLDRNRD 107 Q G R+ N + N+ N +QN Q D NR+ Sbjct: 505 QNGNRQNDNKRNGNRQNDNQNNQNDNNRN 533 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 495 YILFSRFSRVVEVIQAYFTIE 557 ++LF FS+ EV+QA+ ++ Sbjct: 148 HLLFRHFSQRQEVLQAFKQVQ 168 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 731 NHN*NYVLSRNHNTFTFSFLLYSMLRIQ 648 N+N NY N+N + L Y+++ I+ Sbjct: 333 NYNNNYNNYNNNNYNNYKKLYYNIINIE 360 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +3 Query: 495 YILFSRFSRVVEVIQAYFTIE 557 ++LF FS+ EV+QA+ ++ Sbjct: 116 HLLFRHFSQRQEVLQAFKQVQ 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,418 Number of Sequences: 438 Number of extensions: 3315 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -