BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1332 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.4 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 4.1 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 7.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -2 Query: 570 IIYNDTIQNYY*TSNHINHMQTDNIQ 493 +I +T+Q ++ NH +H+Q+ +Q Sbjct: 132 LIKQETLQRHHHLQNHHHHLQSTAVQ 157 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -1 Query: 121 VRYETNTIAVQHSSCSLCHRSFINAGS 41 V YE S CSLC R F G+ Sbjct: 260 VDYEDEFDEFGDSKCSLCQRRFEEQGN 286 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/34 (29%), Positives = 19/34 (55%) Frame = +3 Query: 6 FYLFILRSVISSLPAFINDRWQSEQDECCTAIVF 107 F +++L + SLP F+ D + + C T+ +F Sbjct: 242 FAVYVLVNGSWSLPGFVCDFYIAMDVTCSTSSIF 275 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,773 Number of Sequences: 438 Number of extensions: 3816 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -