BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1329 (785 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5N615 Cluster: Putative uncharacterized protein; n=2; ... 34 4.6 UniRef50_A6CFH9 Cluster: 2-dehydro-3-deoxyphosphooctonate aldola... 33 8.1 >UniRef50_Q5N615 Cluster: Putative uncharacterized protein; n=2; Synechococcus elongatus|Rep: Putative uncharacterized protein - Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)(Anacystis nidulans) Length = 192 Score = 33.9 bits (74), Expect = 4.6 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = +3 Query: 234 RAVRCI*VFRALSGFK-VRNRSLYRDRSGMYANVSRTVSGCGVSGELF-WSFNSLI 395 R RC+ +F L+GF + + +L+RDR G +S V G VSG +F W SLI Sbjct: 107 RLNRCVLLF-VLAGFSLIGSATLFRDRLGETILISTLVEGAVVSGWVFLWEAVSLI 161 >UniRef50_A6CFH9 Cluster: 2-dehydro-3-deoxyphosphooctonate aldolase; n=1; Planctomyces maris DSM 8797|Rep: 2-dehydro-3-deoxyphosphooctonate aldolase - Planctomyces maris DSM 8797 Length = 563 Score = 33.1 bits (72), Expect = 8.1 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -1 Query: 188 IRNLWHAHKLNKYQRIKGIFCFFFSIFNLETNEE*PSKTSVRKEIIEGTA 39 + NL H + I G+FCF I E+ PS ++ KE +GTA Sbjct: 3 LSNLIRRHSAPRLGMISGVFCFALLISISGCKEQTPSSSTANKEKSQGTA 52 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 661,540,857 Number of Sequences: 1657284 Number of extensions: 11759330 Number of successful extensions: 24810 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24808 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 66673674990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -