BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1329 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58701| Best HMM Match : bZIP_2 (HMM E-Value=1.6) 32 0.61 SB_33601| Best HMM Match : Metallophos (HMM E-Value=6.4e-19) 28 9.9 >SB_58701| Best HMM Match : bZIP_2 (HMM E-Value=1.6) Length = 940 Score = 31.9 bits (69), Expect = 0.61 Identities = 14/58 (24%), Positives = 33/58 (56%) Frame = -3 Query: 747 TKLTNVSTYKSDAGVETIKLELQENLISWISNGVC*INQKRLPYNRLTLTVPRHLVRT 574 TKL+++ + +SDA + ++ L +Q N + +S NQ ++ + +P++ +R+ Sbjct: 219 TKLSDLGSIRSDANLHSMDLAIQSNTVDGLSAQASGGNQNSYAFSCFSCEIPQNSLRS 276 >SB_33601| Best HMM Match : Metallophos (HMM E-Value=6.4e-19) Length = 675 Score = 27.9 bits (59), Expect = 9.9 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 4/38 (10%) Frame = +2 Query: 224 YTRPRCPMHL-SVSGFKRI*SSKQVVISR---SVRYVC 325 YT P+ P+HL S S KRI SK++ R S+R +C Sbjct: 287 YTNPKAPVHLTSGSALKRILRSKELQRRRQHASLRDIC 324 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,870,828 Number of Sequences: 59808 Number of extensions: 387122 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 587 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -