BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1327X (497 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 1.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 7.6 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 25.4 bits (53), Expect = 1.1 Identities = 16/64 (25%), Positives = 31/64 (48%) Frame = +2 Query: 266 QQLKTSREQCQQLLKEREDNEVETLQVIKKNTMLKGQLSQLFIEYNEVLETNKKLQIVVD 445 QQ+K +E+ KE + + +++K+N LK ++ + E +V NK + Sbjct: 871 QQIKQHKEKMNSQSKELKAKYHQRDKLLKQNDELKLEIKKKENEITKVRNENKDGYDRIS 930 Query: 446 GFDQ 457 G +Q Sbjct: 931 GMEQ 934 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 7.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -2 Query: 424 LVSLKNFIVFNEELRQLAFQHGIFLYYL 341 L L++ +V N LA +HG Y+L Sbjct: 2048 LTDLRSALVNNTIFASLAVRHGFHKYFL 2075 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,030 Number of Sequences: 2352 Number of extensions: 6143 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44400195 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -