BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1315 (635 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 26 0.23 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 2.8 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 22 4.9 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.2 bits (55), Expect = 0.23 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 136 SSNAFRFDGWGSCCNYTETLELISQGGWR 50 + N+ ++ G Y E +EL +GGW+ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWK 312 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 135 AVMRFGLTGGAAVVTILRP*NSYLKVGGVIYVVDV 31 A+ +TG + L P + V G+IY++ + Sbjct: 1005 AIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSI 1039 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 135 AVMRFGLTGGAAVVTILRP*NSYLKVGGVIYVVDV 31 A+ +TG + L P + V G+IY++ + Sbjct: 1005 AIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSI 1039 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 135 AVMRFGLTGGAAVVTILRP*NSYLKVGGVIYVVDV 31 A+ +TG + L P + V G+IY++ + Sbjct: 1005 AIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSI 1039 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.8 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = -3 Query: 135 AVMRFGLTGGAAVVTILRP*NSYLKVGGVIYVVDV 31 A+ +TG + L P + V G+IY++ + Sbjct: 1005 AIFLIAMTGSFFIAACLHPQEFWCIVPGIIYLLSI 1039 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.8 bits (44), Expect = 4.9 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 130 NAFRFDGWGSCCNYTETLELISQGGW 53 +A R+ G Y E +E + GGW Sbjct: 290 DAGRYTGERGMMGYNEIVEAQNAGGW 315 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,022 Number of Sequences: 336 Number of extensions: 3136 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16397237 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -