BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1315 (635 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF213473-1|AAL50027.1| 913|Caenorhabditis elegans basic helix-l... 29 2.8 AF016688-7|AAB66080.1| 726|Caenorhabditis elegans Hypothetical ... 28 4.9 >AF213473-1|AAL50027.1| 913|Caenorhabditis elegans basic helix-loop-helix leucinezipper WBSCR14-like protein protein. Length = 913 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +3 Query: 96 QQLPHPSNRNALLLHGRNWWCLPVRTQDVLPPVR*FVITPI 218 Q PHP++ + ++ R+WW T V P+ V TP+ Sbjct: 423 QPTPHPNSHDPMMAPSRSWWLDSPLTASVQSPLS--VATPL 461 >AF016688-7|AAB66080.1| 726|Caenorhabditis elegans Hypothetical protein F18A12.1 protein. Length = 726 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 110 PVKPKRITASRQKLVVPTRADSRRPATSKV 199 PV+P R+ QKLV P + P T+ V Sbjct: 38 PVEPPRVAPIAQKLVAPEKKSRPEPVTNPV 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,963,481 Number of Sequences: 27780 Number of extensions: 275665 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1406256614 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -