BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1315 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 1.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 4.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 5.7 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 21 7.6 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 21 7.6 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 23.4 bits (48), Expect = 1.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 132 LLHGRNWWCLPVRTQDVL 185 L+H N+ C VR QDV+ Sbjct: 374 LIHAGNYTCHAVRNQDVV 391 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = -2 Query: 109 WGSCCNYTETLELISQGGWRHLRC 38 WGSC NY T ++ L C Sbjct: 98 WGSCNNYWNTKNCVNPYDRDSLSC 121 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 5.7 Identities = 7/25 (28%), Positives = 17/25 (68%) Frame = +2 Query: 437 WDRSKKQKKKDNYKFTKQ*TNITYE 511 +DR K+++ +NY + + T+I ++ Sbjct: 176 YDRYKEEESNENYNWEHKETHIDWQ 200 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 239 YAPSIAKYWCYYKLPYWWQDVLSPHG*APP 150 Y PS+ + + + +P + D++ PH A P Sbjct: 21 YVPSMREKFLGWNVPPEYSDLVRPHWRAFP 50 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -1 Query: 239 YAPSIAKYWCYYKLPYWWQDVLSPHG*APP 150 Y PS+ + + + +P + D++ PH A P Sbjct: 21 YVPSMREKFLGWNVPPEYSDLVHPHWRAFP 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,395 Number of Sequences: 438 Number of extensions: 3528 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -