BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1314 (810 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) 184 1e-46 SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) 95 5e-20 SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 2e-19 SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) 86 3e-17 SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 3e-16 SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) 61 1e-09 SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 42 6e-04 SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) 39 0.004 SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) 35 0.068 SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) 29 4.5 SB_32671| Best HMM Match : SerH (HMM E-Value=0.4) 29 5.9 SB_39625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_50882| Best HMM Match : Metallophos (HMM E-Value=8.00001e-41) Length = 293 Score = 184 bits (447), Expect = 1e-46 Identities = 84/86 (97%), Positives = 85/86 (98%) Frame = +2 Query: 257 EIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY 436 EI+GLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY Sbjct: 34 EIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY 93 Query: 437 VDRGKQSLETICLLLAYKIKYPENSF 514 VDRGKQSLETICLLLAYKIKYPEN F Sbjct: 94 VDRGKQSLETICLLLAYKIKYPENFF 119 Score = 136 bits (328), Expect = 3e-32 Identities = 62/80 (77%), Positives = 66/80 (82%) Frame = +1 Query: 508 FFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLS 687 FFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAI+DEKIFCCHG Sbjct: 118 FFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHG--D 175 Query: 688 PDLQAMEQIRRIMRPTDVPD 747 D+Q + R + T PD Sbjct: 176 KDVQGWGENDRGVSFTFGPD 195 Score = 47.2 bits (107), Expect = 2e-05 Identities = 18/35 (51%), Positives = 30/35 (85%) Frame = +3 Query: 165 DTDELNIDNVIKKLLKVRGEKPGMNVQLTE*KLKG 269 + ++LN+D++I +LL+VRG +PG NVQLTE +++G Sbjct: 3 EPEKLNVDSIISRLLEVRGSRPGKNVQLTEAEIRG 37 >SB_38314| Best HMM Match : Metallophos (HMM E-Value=5.1e-07) Length = 199 Score = 95.5 bits (227), Expect = 5e-20 Identities = 41/90 (45%), Positives = 62/90 (68%), Gaps = 1/90 (1%) Frame = +2 Query: 224 EAWYECS-VDGIEIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGF 400 E EC + ++K LC K++EI + + E++ P+ +CGD+HGQ++DL+ LF GG Sbjct: 16 EQLMECKQLTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGK 75 Query: 401 PPESNYLFLGDYVDRGKQSLETICLLLAYK 490 P++NYLF+GDYVDRG S+ET+ LL+ K Sbjct: 76 SPDTNYLFMGDYVDRGYYSVETVTLLVTLK 105 >SB_52368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 93.1 bits (221), Expect = 2e-19 Identities = 41/66 (62%), Positives = 52/66 (78%) Frame = +2 Query: 257 EIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY 436 +I+ +C SREIFL QP+LLE+ AP+ I GDIHGQY DLLR F+ G+PP +Y+FLGDY Sbjct: 36 QIRQICQVSREIFLQQPMLLEIGAPINIFGDIHGQYEDLLRHFDKLGYPPNESYIFLGDY 95 Query: 437 VDRGKQ 454 VDR K+ Sbjct: 96 VDRPKR 101 >SB_49199| Best HMM Match : Metallophos (HMM E-Value=2.5e-25) Length = 173 Score = 86.2 bits (204), Expect = 3e-17 Identities = 38/83 (45%), Positives = 55/83 (66%) Frame = +2 Query: 257 EIKGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDY 436 ++K LC E+ L + + + +P+ +CGDIHGQ+YDL LF GG P ++Y+F+GD+ Sbjct: 21 DLKKLCDYVCELLLEESNVQPVSSPVTVCGDIHGQFYDLEELFRTGGQVPNTSYVFMGDF 80 Query: 437 VDRGKQSLETICLLLAYKIKYPE 505 VDRG SLET LL K K+P+ Sbjct: 81 VDRGYYSLETFTRLLTLKAKWPD 103 Score = 82.2 bits (194), Expect = 5e-16 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 1/67 (1%) Frame = +1 Query: 514 LLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP 690 LLRGNHE I ++YGFYDEC+ +Y N W+ F+ L VAAI+D ++ C HGGLSP Sbjct: 107 LLRGNHESRQITQVYGFYDECQSKYGNANAWRYCCKVFDLLTVAAIIDGQVLCVHGGLSP 166 Query: 691 DLQAMEQ 711 D++ ++Q Sbjct: 167 DIKTIDQ 173 >SB_31501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 83.0 bits (196), Expect = 3e-16 Identities = 34/60 (56%), Positives = 46/60 (76%) Frame = +2 Query: 290 IFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETI 469 I + +LE++AP+ +CGDIHGQ+YDL++LFE GG P + YLFLGDYVDRG S+E + Sbjct: 69 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECL 128 Score = 54.0 bits (124), Expect = 1e-07 Identities = 19/62 (30%), Positives = 41/62 (66%) Frame = +1 Query: 577 KRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQIRRIMRPTDVPDQGL 756 K +Y+ ++ + F+CLP+AA+++++ C HGGLSP++ ++ ++++ R + P G Sbjct: 188 KIKYSEAVYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPPAFGP 247 Query: 757 LC 762 +C Sbjct: 248 MC 249 >SB_49265| Best HMM Match : efhand (HMM E-Value=0.68) Length = 720 Score = 60.9 bits (141), Expect = 1e-09 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 4/69 (5%) Frame = +2 Query: 269 LCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLL----RLFEYGGFPPESNYLFLGDY 436 +C RE+ + +P +L +++P+ + GD+HG + DL+ L+ G SN+LFLGDY Sbjct: 652 VCRSLREVVMEEPRMLRVQSPVYVLGDLHGNFRDLVCFEKLLWRMGPVLTPSNFLFLGDY 711 Query: 437 VDRGKQSLE 463 VDRG+ +E Sbjct: 712 VDRGENGVE 720 >SB_36816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 48.8 bits (111), Expect = 5e-06 Identities = 32/76 (42%), Positives = 41/76 (53%), Gaps = 2/76 (2%) Frame = +1 Query: 541 SINRIYGFYDECKRR--YNIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLQAMEQI 714 S+ + F E RR I+L + T F+ P +A K P++ +MEQI Sbjct: 4 SVLGVVNFRREWARRKFLLIQLQQASTAIFDYAPYSACAQRKTLA---NFPPNM-SMEQI 59 Query: 715 RRIMRPTDVPDQGLLC 762 RRIMRPTDVPD GLLC Sbjct: 60 RRIMRPTDVPDTGLLC 75 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/20 (75%), Positives = 15/20 (75%) Frame = +3 Query: 750 GFALHLLWSDPDKDTAGWGE 809 G LLWSDPDKDT GWGE Sbjct: 72 GLLCDLLWSDPDKDTNGWGE 91 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +2 Query: 395 GFP-PESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENSF 514 G P PE+ Y+F GD VDRG +S+E +L A+ I YP + Sbjct: 2 GLPSPENPYIFNGDLVDRGPRSIEICIILFAFTILYPNGVY 42 Score = 40.3 bits (90), Expect = 0.002 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 6/76 (7%) Frame = +1 Query: 511 FLLRGNHECASIN-RIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHG 678 ++ RGNHE +N RI K +Y ++ +TF LP+A IV+ KIF HG Sbjct: 42 YINRGNHEDHIMNLRIIVTKAGGKDQYKDSRSEIIRTFRKYLGWLPLATIVNNKIFVAHG 101 Query: 679 GLS--PDLQAMEQIRR 720 G+S DL +E+I R Sbjct: 102 GISNITDLDIIERIDR 117 >SB_1044| Best HMM Match : Metallophos (HMM E-Value=5.8e-16) Length = 250 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/54 (38%), Positives = 27/54 (50%) Frame = +2 Query: 338 ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY 499 + GDIHG L +LFE +FLGDYVD +S TI L+ K+ Sbjct: 7 VFGDIHGGLRALQQLFERAEITINDKLIFLGDYVDGWSESAATIQFLIEIAEKH 60 >SB_10504| Best HMM Match : MBOAT (HMM E-Value=0.16) Length = 465 Score = 35.1 bits (77), Expect = 0.068 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 750 GFALHLLWSDPDKDTAGWGE 809 G LLWSDPD+D GWG+ Sbjct: 124 GLVCDLLWSDPDEDITGWGD 143 >SB_42654| Best HMM Match : Tfb4 (HMM E-Value=0.0028) Length = 128 Score = 29.1 bits (62), Expect = 4.5 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -2 Query: 551 LLMLAHSWFPRKRKNSRD-I*SCRRGAGILFPTTACHGPHSLRGRDSWTPEGSHHTQTTL 375 L++L +S+ K N + + G+ L+P +C G SL +DS + S T L Sbjct: 42 LMVLCNSYLLLKHNNLLAFVAASTNGSKFLYPKASCEGIQSLPSQDSKYEKFSEFNDTVL 101 Query: 374 R 372 R Sbjct: 102 R 102 >SB_32671| Best HMM Match : SerH (HMM E-Value=0.4) Length = 406 Score = 28.7 bits (61), Expect = 5.9 Identities = 14/48 (29%), Positives = 30/48 (62%) Frame = +3 Query: 387 SMVASLRSPTISSSETMWTVASSRWKQYACSSPTRLNIPRILSFTRKP 530 S+ AS +PT S+ ++ ++ S+ + + +SP+ L+ +LSF+ +P Sbjct: 201 SLEASSNTPTALSATSLMSLPSTSSLKASSNSPSALSTTSLLSFSIQP 248 >SB_39625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 902 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 429 ETMWTVASSRWKQYACSSPTRLNIPRILSFTRKP 530 E + T + RWK + P R+ +PR L R+P Sbjct: 296 EPLPTEINQRWKAWGSRLPERIEVPRSLPDHREP 329 >SB_33568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1555 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 798 RPCPCRGRTRASAEQTLVGN 739 RPC CRGR A + TLV N Sbjct: 275 RPCQCRGRCPALPDGTLVEN 294 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,010,587 Number of Sequences: 59808 Number of extensions: 591416 Number of successful extensions: 1686 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1681 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -