BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1307 (731 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces... 26 4.8 SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase G... 25 8.4 >SPBC26H8.07c |nda3|ben1, alp12|tubulin beta |Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 26.2 bits (55), Expect = 4.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -2 Query: 571 VANMAKLICISNFAFNDIYQFVAEIKFTSYDVTN 470 V N + CI N A + I+ +IK SYD N Sbjct: 193 VENSDETFCIDNEALSSIFANTLKIKSPSYDDLN 226 >SPAPB1E7.05 |gde1||glycerophosphoryl diester phosphodiesterase Gde1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 25.4 bits (53), Expect = 8.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +2 Query: 41 YVKNLLLIMFANFFTCYISVF*FNFVNSSQNISKLKRK 154 Y + + + FAN Y S+ +NSSQN S++K K Sbjct: 95 YEQKVCKLDFANSSKIYESMIALKALNSSQNDSEVKDK 132 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,767,667 Number of Sequences: 5004 Number of extensions: 54751 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -