BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1306 (748 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0461 + 3618414-3618782,3619664-3619794,3620177-3620294,362... 29 3.9 08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-94... 29 5.2 >12_01_0461 + 3618414-3618782,3619664-3619794,3620177-3620294, 3620602-3620654,3620758-3620807,3620912-3621010, 3621511-3621620,3621773-3621900,3622071-3622161, 3622610-3622693,3622863-3623083,3623449-3623527, 3624134-3624283,3624326-3624470,3624604-3624983, 3625096-3625197 Length = 769 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = -3 Query: 524 KVAEINRSRVSLPLSLISSFAHSILVFFDRPLPPLPCTTISIH 396 K+ + V P SSF FF R L PL CT +++H Sbjct: 524 KLKASDADTVQFPEQASSSFLAYYCYFFPRILFPLLCTVVNVH 566 >08_01_0118 + 947394-947885,948709-948810,948914-949219,949557-949616 Length = 319 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/31 (48%), Positives = 17/31 (54%), Gaps = 3/31 (9%) Frame = -2 Query: 483 LSHIIIRTLHPRLFRSTSSPS---TLHYHFH 400 L H + LHPR S+SSPS LH H H Sbjct: 10 LHHHLPNPLHPRHLSSSSSPSPPPPLHLHLH 40 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,281,738 Number of Sequences: 37544 Number of extensions: 285414 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 595 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1980691104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -