BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1306 (748 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 27 0.61 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 25 3.3 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 27.1 bits (57), Expect = 0.61 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 40 YYDCILYFYNHKFRQDYTIKNINKDKQYFIYSQFDNRRQEQ 162 YY Y H F+ ++ N N Q Y QF N+ QE+ Sbjct: 969 YYYKYYKQYPHLFKDYFSQYNKNHKYQNDYYEQFGNKNQEE 1009 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 3.3 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -2 Query: 504 ITRFTPSLSHIIIRTLHPRLFRSTSSPSTLHYHFH 400 +T P +++ L P T + S LH+H H Sbjct: 1285 VTGVEPEKEFVVMPRLPPSRSEDTLNSSHLHHHLH 1319 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,169 Number of Sequences: 2352 Number of extensions: 13361 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -