BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--1306 (748 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U56961-3|AAK39294.1| 634|Caenorhabditis elegans Hypothetical pr... 29 2.6 Z36752-1|CAA85323.2| 150|Caenorhabditis elegans Hypothetical pr... 29 4.6 AF039048-11|AAB94232.1| 421|Caenorhabditis elegans Hypothetical... 28 6.1 Z75543-13|CAI79192.1| 281|Caenorhabditis elegans Hypothetical p... 28 8.1 Z75543-12|CAA99874.4| 280|Caenorhabditis elegans Hypothetical p... 28 8.1 AY728061-1|AAU43722.1| 281|Caenorhabditis elegans cadmium-induc... 28 8.1 >U56961-3|AAK39294.1| 634|Caenorhabditis elegans Hypothetical protein T19D7.4 protein. Length = 634 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +1 Query: 37 HYYDCILYFYNHKFRQDYTIKNINKDKQYF 126 H +D ILYFYN K +D T + K Q F Sbjct: 492 HIWDVILYFYNLKTGRDTTDAPVRKLSQSF 521 >Z36752-1|CAA85323.2| 150|Caenorhabditis elegans Hypothetical protein F35H8.1 protein. Length = 150 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 8/47 (17%) Frame = +1 Query: 13 SDWNCKFVHYYDCILYFYNHKFRQ--------DYTIKNINKDKQYFI 129 +DW H+ D LYF H + Q ++ K I KD++Y + Sbjct: 89 TDWKVTNAHFNDNTLYFNIHNYNQHLAIYPDLEFEAKKIGKDERYIL 135 >AF039048-11|AAB94232.1| 421|Caenorhabditis elegans Hypothetical protein F16B4.1 protein. Length = 421 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 657 IDLSSVLNKYTKFRVNPTF*RGSKSSSKIPLHTY 556 +DLS ++NK T+ +NP F + +K S + T+ Sbjct: 150 VDLSQLVNKATRMLLNPIFTKKTKKMSNLEQLTH 183 >Z75543-13|CAI79192.1| 281|Caenorhabditis elegans Hypothetical protein K01D12.13b protein. Length = 281 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 248 VSICIILKKY*HCALLLYILYKCGKFHTPPS 340 +SIC K A +Y +YK KF TPP+ Sbjct: 1 MSICAHSKLIFASAAAIYAVYKINKFFTPPT 31 >Z75543-12|CAA99874.4| 280|Caenorhabditis elegans Hypothetical protein K01D12.13a protein. Length = 280 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 248 VSICIILKKY*HCALLLYILYKCGKFHTPPS 340 +SIC K A +Y +YK KF TPP+ Sbjct: 1 MSICAHSKLIFASAAAIYAVYKINKFFTPPT 31 >AY728061-1|AAU43722.1| 281|Caenorhabditis elegans cadmium-inducible lysosomal proteinCDR-7 protein. Length = 281 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 248 VSICIILKKY*HCALLLYILYKCGKFHTPPS 340 +SIC K A +Y +YK KF TPP+ Sbjct: 1 MSICAHSKLIFASAAAIYAVYKINKFFTPPT 31 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,550,846 Number of Sequences: 27780 Number of extensions: 299603 Number of successful extensions: 687 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1766990064 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -